Cla97C02G026340 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATAAAGGTAGCGGGAAGACATGGAAATAAAGGTATTGTTTCAAAAATTTTGCCTAGAGAAGATATGCCTTATTTGCAAAATGGAAGACCTATTGATATGGTTTTCAATCCATTAGGAGTCCCCTCACGAATGAATGTAGGACAGATATTTGAGTGCTCACTCGGGTTAGTGGGATATACTTCTATCACAACATATATAAGTATTAGAAGTCTATCACACGTAGCAATGAACGATATGTTTTGTGGTTAA ATGATAAAGGTAGCGGGAAGACATGGAAATAAAGGTATTGTTTCAAAAATTTTGCCTAGAGAAGATATGCCTTATTTGCAAAATGGAAGACCTATTGATATGGTTTTCAATCCATTAGGAGTCCCCTCACGAATGAATGTAGGACAGATATTTGAGTGCTCACTCGGGTTAGTGGGATATACTTCTATCACAACATATATAAGTATTAGAAGTCTATCACACGTAGCAATGAACGATATGTTTTGTGGTTAA ATGATAAAGGTAGCGGGAAGACATGGAAATAAAGGTATTGTTTCAAAAATTTTGCCTAGAGAAGATATGCCTTATTTGCAAAATGGAAGACCTATTGATATGGTTTTCAATCCATTAGGAGTCCCCTCACGAATGAATGTAGGACAGATATTTGAGTGCTCACTCGGGTTAGTGGGATATACTTCTATCACAACATATATAAGTATTAGAAGTCTATCACACGTAGCAATGAACGATATGTTTTGTGGTTAA MIKVAGRHGNKGIVSKILPREDMPYLQNGRPIDMVFNPLGVPSRMNVGQIFECSLGLVGYTSITTYISIRSLSHVAMNDMFCG
BLAST of Cla97C02G026340 vs. NCBI nr
Match: AXR94568.1 (RNA polymerase beta subunit (chloroplast) [Hodgsonia macrocarpa] >AXR94654.1 RNA polymerase beta subunit (chloroplast) [Hodgsonia macrocarpa] >AXR94738.1 RNA polymerase beta subunit (chloroplast) [Hodgsonia macrocarpa] >AXR94823.1 RNA polymerase beta subunit (chloroplast) [Hodgsonia macrocarpa]) HSP 1 Score: 120.2 bits (300), Expect = 3.4e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. NCBI nr
Match: AHM88679.1 (RNA polymerase beta subunit (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 120.2 bits (300), Expect = 3.4e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. NCBI nr
Match: AHM88738.1 (RNA polymerase beta subunit (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 120.2 bits (300), Expect = 3.4e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. NCBI nr
Match: AHM88796.1 (RNA polymerase beta subunit (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 120.2 bits (300), Expect = 3.4e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. NCBI nr
Match: AHM88854.1 (RNA polymerase beta subunit, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 120.2 bits (300), Expect = 3.4e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TrEMBL
Match: tr|X2F838|X2F838_LAGSI (DNA-directed RNA polymerase subunit beta OS=Lagenaria siceraria OX=3668 GN=rpoB PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 2.3e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TrEMBL
Match: tr|X2F6I7|X2F6I7_LAGSI (DNA-directed RNA polymerase subunit beta OS=Lagenaria siceraria OX=3668 GN=rpoB PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 2.3e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TrEMBL
Match: tr|X2F2Y5|X2F2Y5_LAGSI (DNA-directed RNA polymerase subunit beta OS=Lagenaria siceraria OX=3668 GN=rpoB PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 2.3e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TrEMBL
Match: tr|X2F5U4|X2F5U4_LAGSI (DNA-directed RNA polymerase subunit beta OS=Lagenaria siceraria OX=3668 GN=rpoB PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 2.3e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TrEMBL
Match: tr|X2F1Y2|X2F1Y2_LAGSI (DNA-directed RNA polymerase subunit beta OS=Lagenaria siceraria OX=3668 GN=rpoB PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 2.3e-24 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. Swiss-Prot
Match: sp|Q4VZP1|RPOB_CUCSA (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus OX=3659 GN=rpoB PE=3 SV=2) HSP 1 Score: 120.2 bits (300), Expect = 1.1e-26 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. Swiss-Prot
Match: sp|Q09MI6|RPOB_CITSI (DNA-directed RNA polymerase subunit beta OS=Citrus sinensis OX=2711 GN=rpoB PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 9.4e-26 Identity = 53/57 (92.98%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. Swiss-Prot
Match: sp|Q09X25|RPOB_MORIN (DNA-directed RNA polymerase subunit beta OS=Morus indica OX=248361 GN=rpoB PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 9.4e-26 Identity = 53/57 (92.98%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. Swiss-Prot
Match: sp|A4QJA7|RPOB_AETCO (DNA-directed RNA polymerase subunit beta OS=Aethionema cordifolium OX=434059 GN=rpoB PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.2e-25 Identity = 52/57 (91.23%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. Swiss-Prot
Match: sp|A4QJJ1|RPOB_AETGR (DNA-directed RNA polymerase subunit beta OS=Aethionema grandiflorum OX=72657 GN=rpoB PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.2e-25 Identity = 52/57 (91.23%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TAIR10
Match: ATCG00190.1 (RNA polymerase subunit beta) HSP 1 Score: 116.7 bits (291), Expect = 6.8e-27 Identity = 52/57 (91.23%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TAIR10
Match: AT4G21710.1 (DNA-directed RNA polymerase family protein) HSP 1 Score: 58.5 bits (140), Expect = 2.2e-09 Identity = 25/56 (44.64%), Postives = 34/56 (60.71%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TAIR10
Match: AT5G45140.1 (nuclear RNA polymerase C2) HSP 1 Score: 52.4 bits (124), Expect = 1.6e-07 Identity = 22/50 (44.00%), Postives = 32/50 (64.00%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TAIR10
Match: AT1G29940.1 (nuclear RNA polymerase A2) HSP 1 Score: 45.1 bits (105), Expect = 2.5e-05 Identity = 21/52 (40.38%), Postives = 31/52 (59.62%), Query Frame = 0
BLAST of Cla97C02G026340 vs. TAIR10
Match: AT3G18090.1 (nuclear RNA polymerase D2B) HSP 1 Score: 42.7 bits (99), Expect = 1.3e-04 Identity = 18/53 (33.96%), Postives = 29/53 (54.72%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|