CsaV3_UNG066540 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATCATTGGCTTGAGATCTGCATACAGGAAGATATTCATGTCTACTGATGCAAATTCTGAAGGGTTGGAAGAACGTCTCAACGAAGTGGTATTGCATATCAAATTCGACCCCTCAGTCTCATACAGACATACAACCTAAAGTTCGTTTCATTTTTGCAGGAACAGCATGAAAAATTGGCTCACATATCTTCAGTTCGTTCCATGATTCAGTCAATTCGTGCATCATTTGAACAAAATCGTCGGGGCATATGCAAATTCAGACTATGGA ATCATTGGCTTGAGATCTGCATACAGGAAGATATTCATGTCTACTGATGCAAATTCTGAAGGGTTGGAAGAACGTCTCAACGAAGTGGAACAGCATGAAAAATTGGCTCACATATCTTCAGTTCGTTCCATGATTCAGTCAATTCGTGCATCATTTGAACAAAATCGTCGGGGCATATGCAAATTCAGACTATGGA ATCATTGGCTTGAGATCTGCATACAGGAAGATATTCATGTCTACTGATGCAAATTCTGAAGGGTTGGAAGAACGTCTCAACGAAGTGGAACAGCATGAAAAATTGGCTCACATATCTTCAGTTCGTTCCATGATTCAGTCAATTCGTGCATCATTTGAACAAAATCGTCGGGGCATATGCAAATTCAGACTATGGA IIGLRSAYRKIFMSTDANSEGLEERLNEVEQHEKLAHISSVRSMIQSIRASFEQNRRGICKFRLWX
BLAST of CsaV3_UNG066540 vs. NCBI nr
Match: KGN66222.1 (hypothetical protein Csa_1G586840 [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 3.4e-27 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. NCBI nr
Match: XP_011659972.1 (PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial [Cucumis sativus] >XP_004135815.2 PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial [Cucumis sativus] >XP_011659973.1 PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial [Cucumis sativus] >XP_011659975.1 PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 3.4e-27 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. NCBI nr
Match: XP_008450839.1 (PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1 [Cucumis melo] >XP_008450840.1 PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1 [Cucumis melo] >XP_016900933.1 PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1 [Cucumis melo]) HSP 1 Score: 124.8 bits (312), Expect = 1.1e-25 Identity = 63/65 (96.92%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. NCBI nr
Match: XP_016900934.1 (PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X2 [Cucumis melo]) HSP 1 Score: 124.8 bits (312), Expect = 1.1e-25 Identity = 63/65 (96.92%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. NCBI nr
Match: XP_022147531.1 (probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X2 [Momordica charantia]) HSP 1 Score: 111.3 bits (277), Expect = 1.3e-21 Identity = 56/65 (86.15%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. TAIR10
Match: AT4G29540.2 (bacterial transferase hexapeptide repeat-containing protein) HSP 1 Score: 76.6 bits (187), Expect = 6.2e-15 Identity = 37/62 (59.68%), Postives = 48/62 (77.42%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. Swiss-Prot
Match: sp|Q9SU91|LPXA_ARATH (Probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPXA PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.1e-13 Identity = 37/62 (59.68%), Postives = 48/62 (77.42%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. TrEMBL
Match: tr|A0A0A0LZD2|A0A0A0LZD2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G586840 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 2.3e-27 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. TrEMBL
Match: tr|A0A1S4DY83|A0A1S4DY83_CUCME (probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1 OS=Cucumis melo OX=3656 GN=LOC103492309 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 7.3e-26 Identity = 63/65 (96.92%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. TrEMBL
Match: tr|A0A1S4DY72|A0A1S4DY72_CUCME (probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X2 OS=Cucumis melo OX=3656 GN=LOC103492309 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 7.3e-26 Identity = 63/65 (96.92%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. TrEMBL
Match: tr|K7L1E6|K7L1E6_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=GLYMA_07G128800 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 5.2e-16 Identity = 43/65 (66.15%), Postives = 53/65 (81.54%), Query Frame = 0
BLAST of CsaV3_UNG066540 vs. TrEMBL
Match: tr|A0A0R0LE95|A0A0R0LE95_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100788388 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 6.8e-16 Identity = 43/65 (66.15%), Postives = 53/65 (81.54%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|