CsaV3_4G008580 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.AATGATAGCTTAGCTTCAATCTTCCAAAGCAATGGTGCTTCCTTTACCGTAGGTAATTTTGTAATATTATTTGCCTTGTTATTTGGTGGCTTCATCATCTTACATCATAAGTTTTCTTAATAACTAAGGTCTTTGTTAGATTACGATTTCATTATTTGAAACTACGTACGTTTCATTTCTCCCGCAGTATGATATTAAAGCATCATAGAGAGAGTTTGATTTTCAATTTTTGAAATTATGCAGCATCCATGCCAGCTTGGTTGAAATGGGGTTTTCGGGTTTCACCAATAAGTTACGGAGAAATTGGCCTTTCTCTGAATGAATTTCTCGCACCAAGGTGGCAAAACGG AATGATAGCTTAGCTTCAATCTTCCAAAGCAATGGTGCTTCCTTTACCGTAGCATCCATGCCAGCTTGGTTGAAATGGGGTTTTCGGGTTTCACCAATAAGTTACGGAGAAATTGGCCTTTCTCTGAATGAATTTCTCGCACCAAGGTGGCAAAACGG AATGATAGCTTAGCTTCAATCTTCCAAAGCAATGGTGCTTCCTTTACCGTAGCATCCATGCCAGCTTGGTTGAAATGGGGTTTTCGGGTTTCACCAATAAGTTACGGAGAAATTGGCCTTTCTCTGAATGAATTTCTCGCACCAAGGTGGCAAAACGG NDSLASIFQSNGASFTVASMPAWLKWGFRVSPISYGEIGLSLNEFLAPRWQNX
BLAST of CsaV3_4G008580 vs. NCBI nr
Match: XP_018845350.1 (PREDICTED: pleiotropic drug resistance protein 3-like [Juglans regia]) HSP 1 Score: 90.5 bits (223), Expect = 1.8e-15 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. NCBI nr
Match: XP_018814339.1 (PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 [Juglans regia]) HSP 1 Score: 90.5 bits (223), Expect = 1.8e-15 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. NCBI nr
Match: XP_011652141.1 (PREDICTED: pleiotropic drug resistance protein 3-like [Cucumis sativus] >KGN59365.1 hypothetical protein Csa_3G814320 [Cucumis sativus]) HSP 1 Score: 85.9 bits (211), Expect = 4.5e-14 Identity = 44/66 (66.67%), Postives = 46/66 (69.70%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. NCBI nr
Match: XP_008443150.1 (PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 [Cucumis melo]) HSP 1 Score: 80.5 bits (197), Expect = 1.9e-12 Identity = 41/66 (62.12%), Postives = 45/66 (68.18%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. NCBI nr
Match: XP_008443151.1 (PREDICTED: pleiotropic drug resistance protein 3-like isoform X2 [Cucumis melo]) HSP 1 Score: 80.5 bits (197), Expect = 1.9e-12 Identity = 41/66 (62.12%), Postives = 45/66 (68.18%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TAIR10
Match: AT2G37280.1 (pleiotropic drug resistance 5) HSP 1 Score: 68.2 bits (165), Expect = 1.8e-12 Identity = 34/66 (51.52%), Postives = 40/66 (60.61%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TAIR10
Match: AT3G53480.1 (pleiotropic drug resistance 9) HSP 1 Score: 68.2 bits (165), Expect = 1.8e-12 Identity = 35/65 (53.85%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TAIR10
Match: AT4G15233.2 (ABC-2 and Plant PDR ABC-type transporter family protein) HSP 1 Score: 60.5 bits (145), Expect = 3.7e-10 Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TAIR10
Match: AT4G15230.1 (pleiotropic drug resistance 2) HSP 1 Score: 59.7 bits (143), Expect = 6.3e-10 Identity = 23/33 (69.70%), Postives = 28/33 (84.85%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TAIR10
Match: AT4G15215.1 (pleiotropic drug resistance 13) HSP 1 Score: 58.5 bits (140), Expect = 1.4e-09 Identity = 22/34 (64.71%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. Swiss-Prot
Match: sp|Q9ZUT8|AB33G_ARATH (ABC transporter G family member 33 OS=Arabidopsis thaliana OX=3702 GN=ABCG33 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 3.2e-11 Identity = 34/66 (51.52%), Postives = 40/66 (60.61%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. Swiss-Prot
Match: sp|Q9LFH0|AB37G_ARATH (ABC transporter G family member 37 OS=Arabidopsis thaliana OX=3702 GN=ABCG37 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 3.2e-11 Identity = 35/65 (53.85%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. Swiss-Prot
Match: sp|Q5W274|PDR3_TOBAC (Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum OX=4097 GN=PDR3 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 4.2e-11 Identity = 26/33 (78.79%), Postives = 31/33 (93.94%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. Swiss-Prot
Match: sp|Q8GU83|AB41G_ORYSJ (ABC transporter G family member 41 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG41 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.3e-09 Identity = 25/32 (78.12%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. Swiss-Prot
Match: sp|Q2QV81|AB49G_ORYSJ (ABC transporter G family member 49 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG49 PE=2 SV=3) HSP 1 Score: 61.6 bits (148), Expect = 3.0e-09 Identity = 29/48 (60.42%), Postives = 32/48 (66.67%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TrEMBL
Match: tr|A0A2I4E4L5|A0A2I4E4L5_9ROSI (pleiotropic drug resistance protein 3-like isoform X1 OS=Juglans regia OX=51240 GN=LOC108986237 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.2e-15 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TrEMBL
Match: tr|A0A2I4GN81|A0A2I4GN81_9ROSI (pleiotropic drug resistance protein 3-like OS=Juglans regia OX=51240 GN=LOC109009355 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.2e-15 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TrEMBL
Match: tr|A0A2N9H4C9|A0A2N9H4C9_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS34570 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 7.9e-15 Identity = 38/48 (79.17%), Postives = 43/48 (89.58%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TrEMBL
Match: tr|A0A2N9G6D3|A0A2N9G6D3_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS26098 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 7.9e-15 Identity = 38/48 (79.17%), Postives = 43/48 (89.58%), Query Frame = 0
BLAST of CsaV3_4G008580 vs. TrEMBL
Match: tr|A0A2N9HR14|A0A2N9HR14_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS42006 PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 7.9e-15 Identity = 38/48 (79.17%), Postives = 43/48 (89.58%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|