CsaV3_2G017860 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.AATAAATTAAAAAGATGTGACGTCCCAAAATCAATGAATGATGTAGGAGTTTCAGAGTGTGATGCTCGTAATTACATAAAACATTTGATCAGTGAGACGTGGAAGAAGCTAAATGAATGCGAGACTGAAAATATTGCCTTGTCTCAAGTTATCATTCAAATGTCTAAGAATCTTGCTCGAATGGCTCATTGCATGTACTTAAATGGCTCATTGCATGTACTTAAAAGGGAGATGGACATG AATAAATTAAAAAGATGTGACGTCCCAAAATCAATGAATGATGTAGGAGTTTCAGAGTGTGATGCTCGTAATTACATAAAACATTTGATCAGTGAGACGTGGAAGAAGCTAAATGAATGCGAGACTGAAAATATTGCCTTGTCTCAAGTTATCATTCAAATGTCTAAGAATCTTGCTCGAATGGCTCATTGCATGTACTTAAATGGCTCATTGCATGTACTTAAAAGGGAGATGGACATG AATAAATTAAAAAGATGTGACGTCCCAAAATCAATGAATGATGTAGGAGTTTCAGAGTGTGATGCTCGTAATTACATAAAACATTTGATCAGTGAGACGTGGAAGAAGCTAAATGAATGCGAGACTGAAAATATTGCCTTGTCTCAAGTTATCATTCAAATGTCTAAGAATCTTGCTCGAATGGCTCATTGCATGTACTTAAATGGCTCATTGCATGTACTTAAAAGGGAGATGGACATG NKLKRCDVPKSMNDVGVSECDARNYIKHLISETWKKLNECETENIALSQVIIQMSKNLARMAHCMYLNGSLHVLKREMDM
BLAST of CsaV3_2G017860 vs. NCBI nr
Match: KGN62107.1 (hypothetical protein Csa_2G298290 [Cucumis sativus]) HSP 1 Score: 135.2 bits (339), Expect = 9.9e-29 Identity = 64/65 (98.46%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. NCBI nr
Match: XP_008460931.1 (PREDICTED: terpene synthase 10-like isoform X1 [Cucumis melo]) HSP 1 Score: 117.1 bits (292), Expect = 2.8e-23 Identity = 61/81 (75.31%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. NCBI nr
Match: XP_008460932.1 (PREDICTED: terpene synthase 10-like isoform X2 [Cucumis melo]) HSP 1 Score: 117.1 bits (292), Expect = 2.8e-23 Identity = 61/81 (75.31%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. NCBI nr
Match: XP_011650166.1 (PREDICTED: terpene synthase 10-like [Cucumis sativus]) HSP 1 Score: 89.7 bits (221), Expect = 4.7e-15 Identity = 45/76 (59.21%), Postives = 53/76 (69.74%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. NCBI nr
Match: XP_008461030.1 (PREDICTED: terpene synthase 10-like [Cucumis melo]) HSP 1 Score: 87.8 bits (216), Expect = 1.8e-14 Identity = 44/76 (57.89%), Postives = 53/76 (69.74%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. TAIR10
Match: AT3G25810.1 (Terpenoid cyclases/Protein prenyltransferases superfamily protein) HSP 1 Score: 53.9 bits (128), Expect = 5.2e-08 Identity = 32/80 (40.00%), Postives = 50/80 (62.50%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. TAIR10
Match: AT3G25820.1 (terpene synthase-like sequence-1,8-cineole) HSP 1 Score: 43.1 bits (100), Expect = 9.2e-05 Identity = 29/78 (37.18%), Postives = 45/78 (57.69%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. TAIR10
Match: AT3G25830.1 (terpene synthase-like sequence-1,8-cineole) HSP 1 Score: 43.1 bits (100), Expect = 9.2e-05 Identity = 29/78 (37.18%), Postives = 45/78 (57.69%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. Swiss-Prot
Match: sp|Q93X23|MYRS_QUEIL (Myrcene synthase, chloroplastic OS=Quercus ilex OX=58334 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-12 Identity = 38/78 (48.72%), Postives = 52/78 (66.67%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. Swiss-Prot
Match: sp|Q6PWU2|ATESY_VITVI ((-)-alpha-terpineol synthase OS=Vitis vinifera OX=29760 PE=1 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.3e-11 Identity = 37/76 (48.68%), Postives = 46/76 (60.53%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. Swiss-Prot
Match: sp|B9T536|TPS10_RICCO (Terpene synthase 10 OS=Ricinus communis OX=3988 GN=TPS10 PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-10 Identity = 37/77 (48.05%), Postives = 52/77 (67.53%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. Swiss-Prot
Match: sp|A7IZZ2|TPS2_CANSA ((+)-alpha-pinene synthase, chloroplastic OS=Cannabis sativa OX=3483 PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.1e-10 Identity = 35/76 (46.05%), Postives = 49/76 (64.47%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. Swiss-Prot
Match: sp|Q8L5K4|GTPS_CITLI (Gamma-terpinene synthase, chloroplastic OS=Citrus limon OX=2708 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.1e-10 Identity = 37/77 (48.05%), Postives = 49/77 (63.64%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. TrEMBL
Match: tr|A0A0A0LMW0|A0A0A0LMW0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G298290 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 6.5e-29 Identity = 64/65 (98.46%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. TrEMBL
Match: tr|A0A1S3CES4|A0A1S3CES4_CUCME (terpene synthase 10-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103499666 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.8e-23 Identity = 61/81 (75.31%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. TrEMBL
Match: tr|A0A1S3CD28|A0A1S3CD28_CUCME (terpene synthase 10-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103499666 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.8e-23 Identity = 61/81 (75.31%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. TrEMBL
Match: tr|A0A1S3CDT7|A0A1S3CDT7_CUCME (terpene synthase 10-like OS=Cucumis melo OX=3656 GN=LOC103499735 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 1.2e-14 Identity = 44/76 (57.89%), Postives = 53/76 (69.74%), Query Frame = 0
BLAST of CsaV3_2G017860 vs. TrEMBL
Match: tr|A0A0A0LQ61|A0A0A0LQ61_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G299910 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 6.5e-13 Identity = 42/76 (55.26%), Postives = 51/76 (67.11%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|