MELO3C004690.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACGGACACATGCAATTCCTAAATGGCAAGGCCTTCTACCTCAATCAGGAGAGATGGTTAGTAAGAACAAATGTTGCTATATGGAGCGGGCACATGCAATTCCCATATTTAATGTTCTTTCAAACAGACAGGTTATTAAGATGGAATGGGGTAACTTCCGATCTTCTCATCTTCCCTTTACCGAATATGATCAAGGTCTAGATTTGGAAATTTTAAACCCGGGGGAACAGGTAAAGGTCCTCTTTTCTTTGATGCCTTAA ATGGAACGGACACATGCAATTCCTAAATGGCAAGGCCTTCTACCTCAATCAGGAGAGATGGTTATTAAGATGGAATGGGGTAACTTCCGATCTTCTCATCTTCCCTTTACCGAATATGATCAAGGTCTAGATTTGGAAATTTTAAACCCGGGGGAACAGGTAAAGGTCCTCTTTTCTTTGATGCCTTAA ATGGAACGGACACATGCAATTCCTAAATGGCAAGGCCTTCTACCTCAATCAGGAGAGATGGTTATTAAGATGGAATGGGGTAACTTCCGATCTTCTCATCTTCCCTTTACCGAATATGATCAAGGTCTAGATTTGGAAATTTTAAACCCGGGGGAACAGGTAAAGGTCCTCTTTTCTTTGATGCCTTAA MERTHAIPKWQGLLPQSGEMVIKMEWGNFRSSHLPFTEYDQGLDLEILNPGEQVKVLFSLMP
BLAST of MELO3C004690.2 vs. NCBI nr
Match: XP_004135675.1 (PREDICTED: hexokinase-1-like [Cucumis sativus] >XP_011659954.1 PREDICTED: hexokinase-1-like [Cucumis sativus] >KGN66181.1 hypothetical protein Csa_1G574970 [Cucumis sativus]) HSP 1 Score: 110.9 bits (276), Expect = 1.5e-21 Identity = 48/54 (88.89%), Postives = 50/54 (92.59%), Query Frame = 0
BLAST of MELO3C004690.2 vs. NCBI nr
Match: NP_001284452.1 (hexokinase-1-like [Cucumis melo] >XP_008450786.1 PREDICTED: hexokinase-1-like isoform X1 [Cucumis melo] >ACJ04705.1 hexokinase 2 [Cucumis melo]) HSP 1 Score: 108.6 bits (270), Expect = 7.7e-21 Identity = 47/54 (87.04%), Postives = 49/54 (90.74%), Query Frame = 0
BLAST of MELO3C004690.2 vs. NCBI nr
Match: XP_022960922.1 (hexokinase-1-like isoform X2 [Cucurbita moschata] >XP_022960923.1 hexokinase-1-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 108.6 bits (270), Expect = 7.7e-21 Identity = 47/54 (87.04%), Postives = 49/54 (90.74%), Query Frame = 0
BLAST of MELO3C004690.2 vs. NCBI nr
Match: XP_022960920.1 (hexokinase-1-like isoform X1 [Cucurbita moschata] >XP_022960921.1 hexokinase-1-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 108.6 bits (270), Expect = 7.7e-21 Identity = 47/54 (87.04%), Postives = 49/54 (90.74%), Query Frame = 0
BLAST of MELO3C004690.2 vs. NCBI nr
Match: XP_022987699.1 (hexokinase-1-like isoform X1 [Cucurbita maxima] >XP_022987701.1 hexokinase-1-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 108.6 bits (270), Expect = 7.7e-21 Identity = 47/54 (87.04%), Postives = 49/54 (90.74%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TAIR10
Match: AT2G19860.1 (hexokinase 2) HSP 1 Score: 100.9 bits (250), Expect = 2.9e-22 Identity = 42/54 (77.78%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TAIR10
Match: AT4G29130.1 (hexokinase 1) HSP 1 Score: 95.5 bits (236), Expect = 1.2e-20 Identity = 41/54 (75.93%), Postives = 45/54 (83.33%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TAIR10
Match: AT1G50460.1 (hexokinase-like 1) HSP 1 Score: 67.4 bits (163), Expect = 3.5e-12 Identity = 32/52 (61.54%), Postives = 35/52 (67.31%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TAIR10
Match: AT4G37840.1 (hexokinase-like 3) HSP 1 Score: 64.3 bits (155), Expect = 3.0e-11 Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TAIR10
Match: AT3G20040.1 (Hexokinase) HSP 1 Score: 58.5 bits (140), Expect = 1.6e-09 Identity = 28/52 (53.85%), Postives = 32/52 (61.54%), Query Frame = 0
BLAST of MELO3C004690.2 vs. Swiss-Prot
Match: sp|P93834|HXK2_ARATH (Hexokinase-2 OS=Arabidopsis thaliana OX=3702 GN=HXK2 PE=1 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 5.2e-21 Identity = 42/54 (77.78%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of MELO3C004690.2 vs. Swiss-Prot
Match: sp|Q42525|HXK1_ARATH (Hexokinase-1 OS=Arabidopsis thaliana OX=3702 GN=HXK1 PE=1 SV=2) HSP 1 Score: 95.5 bits (236), Expect = 2.2e-19 Identity = 41/54 (75.93%), Postives = 45/54 (83.33%), Query Frame = 0
BLAST of MELO3C004690.2 vs. Swiss-Prot
Match: sp|Q2KNB9|HXK2_ORYSJ (Hexokinase-2 OS=Oryza sativa subsp. japonica OX=39947 GN=HXK2 PE=2 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.2e-19 Identity = 41/54 (75.93%), Postives = 46/54 (85.19%), Query Frame = 0
BLAST of MELO3C004690.2 vs. Swiss-Prot
Match: sp|Q9SQ76|HXK2_SOLTU (Hexokinase-2 OS=Solanum tuberosum OX=4113 GN=HXK2 PE=2 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.4e-18 Identity = 39/54 (72.22%), Postives = 43/54 (79.63%), Query Frame = 0
BLAST of MELO3C004690.2 vs. Swiss-Prot
Match: sp|O64390|HXK1_SOLTU (Hexokinase-1 OS=Solanum tuberosum OX=4113 GN=HXK1 PE=1 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.1e-18 Identity = 39/54 (72.22%), Postives = 43/54 (79.63%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TrEMBL
Match: tr|A0A0A0M1R9|A0A0A0M1R9_CUCSA (Phosphotransferase OS=Cucumis sativus OX=3659 GN=Csa_1G574970 PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.0e-21 Identity = 48/54 (88.89%), Postives = 50/54 (92.59%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TrEMBL
Match: tr|B6V3C1|B6V3C1_CUCME (Phosphotransferase OS=Cucumis melo OX=3656 GN=LOC103492265 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 5.1e-21 Identity = 47/54 (87.04%), Postives = 49/54 (90.74%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TrEMBL
Match: tr|A0A2P5FRW9|A0A2P5FRW9_9ROSA (Phosphotransferase OS=Trema orientalis OX=63057 GN=TorRG33x02_036210 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.5e-20 Identity = 45/54 (83.33%), Postives = 49/54 (90.74%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TrEMBL
Match: tr|A0A2P5B8Q5|A0A2P5B8Q5_PARAD (Phosphotransferase OS=Parasponia andersonii OX=3476 GN=PanWU01x14_261240 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.5e-20 Identity = 45/54 (83.33%), Postives = 49/54 (90.74%), Query Frame = 0
BLAST of MELO3C004690.2 vs. TrEMBL
Match: tr|A0A068U3Z1|A0A068U3Z1_COFCA (Phosphotransferase OS=Coffea canephora OX=49390 GN=GSCOC_T00041766001 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.3e-20 Identity = 45/54 (83.33%), Postives = 48/54 (88.89%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|