MELO3C026355.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATTAGTAGATTGTGTATCATGTATATACGTTTTCAAATTCATAACTATTTAATAAAAAAGAATGTTGATTAGATCAAAATTGAAAGTCACCAATAATTTTCGTTTATCATGGGTAAGGACACTATTACTAACATAATAACCTCTATTCGTAATGCTGACATGAATAGAAAAGGAATGGTTCAAATACCATCTACTAACATCACCGAAAACATTGTGAAAAGACTTTTACGAGAAGGTTTTATTGAAAACTTAAGGAAACATTGGGAAAACAACAAGGATTTTTAGGTTTGAACCCTACAACATAGAAGAAATAGGAAAGGA ATTAGTAGATTGTGTATCATGTATATACGTTTTCAAATTCATAACTATTTAATAAAAAAGAATGTTGATTAGATCAAAATTGAAAGTCACCAATAATTTTCGTTTATCATGGGTAAGGACACTATTACTAACATAATAACCTCTATTCGTAATGCTGACATGAATAGAAAAGGAATGGTTCAAATACCATCTACTAACATCACCGAAAACATTGTGAAAAGACTTTTACGAGAAGGTTTTATTGAAAACTTAAGGAAACATTGGGAAAACAACAAGGATTTTTAGGTTTGAACCCTACAACATAGAAGAAATAGGAAAGGA ATGGGTAAGGACACTATTACTAACATAATAACCTCTATTCGTAATGCTGACATGAATAGAAAAGGAATGGTTCAAATACCATCTACTAACATCACCGAAAACATTGTGAAAAGACTTTTACGAGAAGGTTTTATTGAAAACTTAAGGAAACATTGGGAAAACAACAAGGATTTTTAG MGKDTITNIITSIRNADMNRKGMVQIPSTNITENIVKRLLREGFIENLRKHWENNKDF
BLAST of MELO3C026355.2 vs. NCBI nr
Match: YP_009236314.1 (ribosomal protein S8 (chloroplast) [Gynostemma pentaphyllum] >YP_009440192.1 ribosomal protein S8 (chloroplast) [Gynostemma longipes] >YP_009440279.1 ribosomal protein S8 (chloroplast) [Gynostemma 'burmanicum'] >YP_009440366.1 ribosomal protein S8 (chloroplast) [Gynostemma pubescens] >AMF84028.1 ribosomal protein S8 (chloroplast) [Gynostemma pentaphyllum] >ANI25219.1 ribosomal protein S8 (chloroplast) [Gynostemma pentaphyllum] >ART65011.1 ribosomal protein S8 (chloroplast) [Gynostemma pentaphyllum] >ATG86939.1 ribosomal protein S8 (chloroplast) [Gynostemma longipes] >ATG87026.1 ribosomal protein S8 (chloroplast) [Gynostemma 'burmanicum'] >ATG87113.1 ribosomal protein S8 (chloroplast) [Gynostemma pubescens]) HSP 1 Score: 106.3 bits (264), Expect = 3.6e-20 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. NCBI nr
Match: YP_009430662.1 (ribosomal protein S8 (chloroplast) [Gynostemma cardiospermum] >YP_009439839.1 ribosomal protein S8 (chloroplast) [Gynostemma laxiflorum] >ART65098.1 ribosomal protein S8 (chloroplast) [Gynostemma cardiospermum] >ATG86678.1 ribosomal protein S8 (chloroplast) [Gynostemma laxiflorum]) HSP 1 Score: 106.3 bits (264), Expect = 3.6e-20 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. NCBI nr
Match: YP_009439926.1 (ribosomal protein S8 (chloroplast) [Gynostemma caulopterum] >YP_009468896.1 ribosomal protein S8 (chloroplast) [Gynostemma compressum] >ATG86766.1 ribosomal protein S8 (chloroplast) [Gynostemma caulopterum] >AVA29857.1 ribosomal protein S8 (chloroplast) [Gynostemma compressum]) HSP 1 Score: 106.3 bits (264), Expect = 3.6e-20 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. NCBI nr
Match: AXR94584.1 (ribosomal protein S8 (chloroplast) [Hodgsonia macrocarpa] >AXR94670.1 ribosomal protein S8 (chloroplast) [Hodgsonia macrocarpa] >AXR94753.1 ribosomal protein S8 (chloroplast) [Hodgsonia macrocarpa] >AXR94839.1 ribosomal protein S8 (chloroplast) [Hodgsonia macrocarpa]) HSP 1 Score: 104.0 bits (258), Expect = 1.8e-19 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. NCBI nr
Match: YP_009326025.1 (ribosomal protein S8 (chloroplast) [Citrullus lanatus] >YP_009348067.1 ribosomal protein S8 (plastid) [Citrullus mucosospermus] >YP_009420830.1 ribosomal protein S8 (chloroplast) [Citrullus colocynthis] >YP_009431678.1 ribosomal protein S8 (chloroplast) [Citrullus rehmii] >YP_009456181.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM88713.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM88772.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM88830.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM88945.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89003.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89062.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89121.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89180.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89239.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89298.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89358.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89417.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89476.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89535.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89595.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89654.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89713.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89772.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89831.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89890.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM89949.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90008.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90067.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90126.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90185.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90244.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90303.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90362.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90421.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90480.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90539.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90598.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90657.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90716.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90775.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90834.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90893.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM90952.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM91070.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM91128.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM91188.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >AHM91303.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria] >APD52516.1 ribosomal protein S8 (chloroplast) [Citrullus lanatus] >APW82753.1 ribosomal protein S8 (plastid) [Citrullus mucosospermus] >APW82838.1 ribosomal protein S8 (plastid) [Citrullus mucosospermus] >APW82923.1 ribosomal protein S8 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83008.1 ribosomal protein S8 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83093.1 ribosomal protein S8 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83178.1 ribosomal protein S8 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83263.1 ribosomal protein S8 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83348.1 ribosomal protein S8 (plastid) [Citrullus mucosospermus] >ASP44481.1 ribosomal protein S8 (chloroplast) [Citrullus colocynthis] >ASY96266.1 ribosomal protein S8 (chloroplast) [Citrullus rehmii] >AUJ21946.1 ribosomal protein S8 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 104.0 bits (258), Expect = 1.8e-19 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. TAIR10
Match: ATCG00770.1 (ribosomal protein S8) HSP 1 Score: 91.3 bits (225), Expect = 2.1e-19 Identity = 47/58 (81.03%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of MELO3C026355.2 vs. Swiss-Prot
Match: sp|Q4VZK0|RR8_CUCSA (30S ribosomal protein S8, chloroplastic OS=Cucumis sativus OX=3659 GN=rps8 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.3e-21 Identity = 51/58 (87.93%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. Swiss-Prot
Match: sp|Q6EW16|RR8_NYMAL (30S ribosomal protein S8, chloroplastic OS=Nymphaea alba OX=34301 GN=rps8 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 2.7e-19 Identity = 47/58 (81.03%), Postives = 53/58 (91.38%), Query Frame = 0
BLAST of MELO3C026355.2 vs. Swiss-Prot
Match: sp|P59033|RR8_PHAAN (30S ribosomal protein S8, chloroplastic OS=Phaseolus angularis OX=3914 GN=rps8 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 2.7e-19 Identity = 47/58 (81.03%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of MELO3C026355.2 vs. Swiss-Prot
Match: sp|Q49KW3|RR8_EUCGG (30S ribosomal protein S8, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rps8 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 6.0e-19 Identity = 47/58 (81.03%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of MELO3C026355.2 vs. Swiss-Prot
Match: sp|Q2PMQ0|RR8_SOYBN (30S ribosomal protein S8, chloroplastic OS=Glycine max OX=3847 GN=rps8 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 6.0e-19 Identity = 47/58 (81.03%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of MELO3C026355.2 vs. TrEMBL
Match: tr|A0A109WXX2|A0A109WXX2_GYNPE (30S ribosomal protein S8, chloroplastic OS=Gynostemma pentaphyllum OX=182084 GN=rps8 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.4e-20 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. TrEMBL
Match: tr|A0A286KU15|A0A286KU15_9ROSI (30S ribosomal protein S8, chloroplastic OS=Gynostemma cardiospermum OX=1739658 GN=rps8 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.4e-20 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. TrEMBL
Match: tr|A0A291IAG7|A0A291IAG7_9ROSI (30S ribosomal protein S8, chloroplastic OS=Gynostemma laxiflorum OX=2041848 GN=rps8 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.4e-20 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. TrEMBL
Match: tr|A0A2L0WR37|A0A2L0WR37_9ROSI (30S ribosomal protein S8, chloroplastic OS=Gynostemma compressum OX=1348125 GN=rps8 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.4e-20 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 0
BLAST of MELO3C026355.2 vs. TrEMBL
Match: tr|A0A291IB69|A0A291IB69_9ROSI (30S ribosomal protein S8, chloroplastic OS=Gynostemma longipes OX=555431 GN=rps8 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.4e-20 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|