MELO3C032362.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ACGAACTTCAAAACGTCTTTGAAAGTGGATGAGATGGGTCGAGTCCTATCTGTAGGAGATGGAATTGCCCGAGTTTATGGATTGAAGGAGATTCAAGCTGGGGAAATGGTGGAATTTTCCAGCGGTGTCAAAGGAATAGCCTTAAATCTTGAGAATGAGAATGTAGGCATTGTTGTCTTTGGTAGTGATACCGCTATTAAGGAAGGAGATCTTGTCAAGCG ACGAACTTCAAAACGTCTTTGAAAGTGGATGAGATGGGTCGAGTCCTATCTGTAGGAGATGGAATTGCCCGAGTTTATGGATTGAAGGAGATTCAAGCTGGGGAAATGGTGGAATTTTCCAGCGGTGTCAAAGGAATAGCCTTAAATCTTGAGAATGAGAATGTAGGCATTGTTGTCTTTGGTAGTGATACCGCTATTAAGGAAGGAGATCTTGTCAAGCg ATGGGTCGAGTCCTATCTGTAGGAGATGGAATTGCCCGAGTTTATGGATTGAAGGAGATTCAAGCTGGGGAAATGGTGGAATTTTCCAGCGGTGTCAAAGGAATAGCCTTAAATCTTGAGAATGAGAATGTAGGCATTGTTGTCTTTGGTAGTGATACCGCTATTAAGGAAGGAGATCTTGTCAAG MGRVLSVGDGIARVYGLKEIQAGEMVEFSSGVKGIALNLENENVGIVVFGSDTAIKEGDLVK
BLAST of MELO3C032362.2 vs. NCBI nr
Match: AFY08517.1 (ATPase subunit 1, partial (mitochondrion) [Eleusine coracana]) HSP 1 Score: 121.3 bits (303), Expect = 1.1e-24 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of MELO3C032362.2 vs. NCBI nr
Match: AEN56122.1 (putative ATP synthase F1 subunit 1 (mitochondrion) [Cucumis melo subsp. melo]) HSP 1 Score: 121.3 bits (303), Expect = 1.1e-24 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of MELO3C032362.2 vs. NCBI nr
Match: AEN56129.1 (ATPase subunit 1 (mitochondrion) [Cucumis melo subsp. melo]) HSP 1 Score: 121.3 bits (303), Expect = 1.1e-24 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of MELO3C032362.2 vs. NCBI nr
Match: YP_008080923.1 (ATPase subunit 1 (mitochondrion) [Butomus umbellatus] >AFY16540.1 ATPase subunit 1 (mitochondrion) [Butomus umbellatus]) HSP 1 Score: 119.0 bits (297), Expect = 5.7e-24 Identity = 60/62 (96.77%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of MELO3C032362.2 vs. NCBI nr
Match: YP_009400336.1 (ATP synthase F1 subunit 1 (mitochondrion) [Stratiotes aloides] >ANY30779.1 ATPase subunit 1 (mitochondrion) [Stratiotes aloides] >ARX11209.1 ATP synthase F1 subunit 1 (mitochondrion) [Stratiotes aloides]) HSP 1 Score: 118.6 bits (296), Expect = 7.4e-24 Identity = 59/62 (95.16%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of MELO3C032362.2 vs. TAIR10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein) HSP 1 Score: 107.1 bits (266), Expect = 4.0e-24 Identity = 53/62 (85.48%), Postives = 59/62 (95.16%), Query Frame = 0
BLAST of MELO3C032362.2 vs. TAIR10
Match: ATMG01190.1 (ATP synthase subunit 1) HSP 1 Score: 107.1 bits (266), Expect = 4.0e-24 Identity = 53/62 (85.48%), Postives = 59/62 (95.16%), Query Frame = 0
BLAST of MELO3C032362.2 vs. TAIR10
Match: ATCG00120.1 (ATP synthase subunit alpha) HSP 1 Score: 79.3 bits (194), Expect = 9.0e-16 Identity = 38/61 (62.30%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of MELO3C032362.2 vs. Swiss-Prot
Match: sp|P05492|ATPAM_OENBI (ATP synthase subunit alpha, mitochondrial OS=Oenothera biennis OX=3942 GN=ATPA PE=3 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 1.6e-25 Identity = 58/62 (93.55%), Postives = 61/62 (98.39%), Query Frame = 0
BLAST of MELO3C032362.2 vs. Swiss-Prot
Match: sp|Q06735|ATPAM_BETVU (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris OX=161934 GN=ATPA PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.0e-25 Identity = 58/62 (93.55%), Postives = 61/62 (98.39%), Query Frame = 0
BLAST of MELO3C032362.2 vs. Swiss-Prot
Match: sp|P18260|ATPAM_HELAN (ATP synthase subunit alpha, mitochondrial OS=Helianthus annuus OX=4232 GN=ATPA PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.0e-25 Identity = 58/62 (93.55%), Postives = 61/62 (98.39%), Query Frame = 0
BLAST of MELO3C032362.2 vs. Swiss-Prot
Match: sp|P05494|ATPAM_MAIZE (ATP synthase subunit alpha, mitochondrial OS=Zea mays OX=4577 GN=ATPA PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.0e-25 Identity = 58/62 (93.55%), Postives = 61/62 (98.39%), Query Frame = 0
BLAST of MELO3C032362.2 vs. Swiss-Prot
Match: sp|P05495|ATPAM_NICPL (ATP synthase subunit alpha, mitochondrial OS=Nicotiana plumbaginifolia OX=4092 GN=ATPA PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.0e-25 Identity = 58/62 (93.55%), Postives = 61/62 (98.39%), Query Frame = 0
BLAST of MELO3C032362.2 vs. TrEMBL
Match: tr|K9N0G2|K9N0G2_ELECO (ATPase subunit 1 (Fragment) OS=Eleusine coracana OX=4511 GN=ATP1 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 7.5e-25 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of MELO3C032362.2 vs. TrEMBL
Match: tr|G3EU05|G3EU05_CUCME (ATP synthase subunit alpha OS=Cucumis melo subsp. melo OX=412675 GN=atp1 PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 7.5e-25 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of MELO3C032362.2 vs. TrEMBL
Match: tr|G3EU37|G3EU37_CUCME (Putative ATP synthase F1 subunit 1 OS=Cucumis melo subsp. melo OX=412675 GN=atp1 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 7.5e-25 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of MELO3C032362.2 vs. TrEMBL
Match: tr|R4IQH4|R4IQH4_BUTUM (ATP synthase subunit alpha OS=Butomus umbellatus OX=50236 GN=atp1 PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 3.7e-24 Identity = 60/62 (96.77%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of MELO3C032362.2 vs. TrEMBL
Match: tr|A0A1B2ARU1|A0A1B2ARU1_9LILI (ATP synthase subunit alpha OS=Stratiotes aloides OX=55494 GN=atp1 PE=3 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 4.9e-24 Identity = 59/62 (95.16%), Postives = 62/62 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|