MELO3C030661.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GGACTCTATTATGGATTTCTGACCACATTCTCCATAGGGCCCTCTTATCTCTTCCTTCTCCGAGCTCGGGTTATGGAAGAAGGAACCGAGAAGAAAGTATCAGCAACAACAGGTTTTATTACGGGACAGCTCATGATGTTCATATCGATCTATTATGCGCCTCTGCATCTAGCATTGGGTAGATGCATTAGGATCCCGATTCATGGATCTCTTGGTTCGAGAAATCAAAATAAATCAAATTTCAAAGTTTATTGAGTTTTAAAACAATAA GGACTCTATTATGGATTTCTGACCACATTCTCCATAGGGCCCTCTTATCTCTTCCTTCTCCGAGCTCGGGTTATGGAAGAAGGAACCGAGAAGAAAGTATCAGCAACAACAGGTTTTATTACGGGACAGCTCATGATGTTCATATCGATCTATTATGCGCCTCTGCATCTAGCATTGGGTAGATGCATTAGGATCCCGATTCATGGATCTCTTGGTTCGAGAAATCAAAATAAATCAAATTTCAAAGTTTATTGAGTTTTAAAACAATAA ATGGAAGAAGGAACCGAGAAGAAAGTATCAGCAACAACAGGTTTTATTACGGGACAGCTCATGATGTTCATATCGATCTATTATGCGCCTCTGCATCTAGCATTGGGTAGATGCATTAGGATCCCGATTCATGGATCTCTTGGTTCGAGAAATCAAAATAAATCAAATTTCAAAGTTTATTGA MEEGTEKKVSATTGFITGQLMMFISIYYAPLHLALGRCIRIPIHGSLGSRNQNKSNFKVY
BLAST of MELO3C030661.2 vs. NCBI nr
Match: YP_247646.1 (hypothetical protein CsCp100 [Cucumis sativus] >CAJ00805.1 hypothetical protein CsCp100 (chloroplast) [Cucumis sativus]) HSP 1 Score: 77.0 bits (188), Expect = 2.4e-11 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. NCBI nr
Match: YP_247658.1 (hypothetical protein CsCp113 [Cucumis sativus] >CAJ00817.1 hypothetical protein CsCp113 (chloroplast) [Cucumis sativus]) HSP 1 Score: 77.0 bits (188), Expect = 2.4e-11 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. NCBI nr
Match: AAZ94706.1 (hypothetical protein (chloroplast) [Cucumis sativus]) HSP 1 Score: 77.0 bits (188), Expect = 2.4e-11 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. NCBI nr
Match: Q4VZL0.2 (RecName: Full=Protein TIC 214; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 214; Short=AtTIC214 >ABI97471.1 hypothetical chloroplast RF1 (chloroplast) [Cucumis sativus] >ABI98801.1 hypothetical chloroplast RF1 (chloroplast) [Cucumis sativus] >ARQ16135.1 hypothetical chloroplast RF1 (chloroplast) [Cucumis sativus] >ARQ16218.1 hypothetical chloroplast RF1 (chloroplast) [Cucumis sativus] >ARQ16301.1 hypothetical chloroplast RF1 (chloroplast) [Cucumis sativus] >ARQ16384.1 hypothetical chloroplast RF1 (chloroplast) [Cucumis sativus]) HSP 1 Score: 77.0 bits (188), Expect = 2.4e-11 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. NCBI nr
Match: YP_009346534.1 (hypothetical protein (chloroplast) [Cucumis x hytivus] >AOW71145.1 hypothetical protein (chloroplast) [Cucumis x hytivus]) HSP 1 Score: 77.0 bits (188), Expect = 2.4e-11 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. TAIR10
Match: AT2G07739.1 (Ycf1 protein) HSP 1 Score: 72.8 bits (177), Expect = 8.2e-14 Identity = 35/36 (97.22%), Postives = 35/36 (97.22%), Query Frame = 0
BLAST of MELO3C030661.2 vs. TAIR10
Match: ATCG01130.1 (Ycf1 protein) HSP 1 Score: 72.8 bits (177), Expect = 8.2e-14 Identity = 35/36 (97.22%), Postives = 35/36 (97.22%), Query Frame = 0
BLAST of MELO3C030661.2 vs. TAIR10
Match: ATCG01000.1 (Ycf1 protein) HSP 1 Score: 72.8 bits (177), Expect = 8.2e-14 Identity = 35/36 (97.22%), Postives = 35/36 (97.22%), Query Frame = 0
BLAST of MELO3C030661.2 vs. TAIR10
Match: ATMG00370.1 (Ycf1 protein) HSP 1 Score: 72.8 bits (177), Expect = 8.2e-14 Identity = 35/36 (97.22%), Postives = 35/36 (97.22%), Query Frame = 0
BLAST of MELO3C030661.2 vs. Swiss-Prot
Match: sp|Q4VZL0|TI214_CUCSA (Protein TIC 214 OS=Cucumis sativus OX=3659 GN=TIC214 PE=3 SV=2) HSP 1 Score: 77.0 bits (188), Expect = 7.8e-14 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. Swiss-Prot
Match: sp|A6MM95|TI214_BUXMI (Protein TIC 214 OS=Buxus microphylla OX=153571 GN=TIC214 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.0e-13 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C030661.2 vs. Swiss-Prot
Match: sp|A0A393|TI214_COFAR (Protein TIC 214 OS=Coffea arabica OX=13443 GN=TIC214 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.0e-13 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C030661.2 vs. Swiss-Prot
Match: sp|Q3C1P6|TI214_NICSY (Protein TIC 214 OS=Nicotiana sylvestris OX=4096 GN=TIC214 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.0e-13 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C030661.2 vs. Swiss-Prot
Match: sp|Q33BW4|TI214_NICTO (Protein TIC 214 OS=Nicotiana tomentosiformis OX=4098 GN=TIC214 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.0e-13 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C030661.2 vs. TrEMBL
Match: tr|A0A218KG90|A0A218KG90_CUCSA (Protein TIC 214 OS=Cucumis sativus var. hardwickii OX=319220 GN=ycf1 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.6e-11 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. TrEMBL
Match: tr|A0A1X9Q205|A0A1X9Q205_CUCSA (Protein TIC 214 OS=Cucumis sativus OX=3659 GN=ycf1 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.6e-11 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. TrEMBL
Match: tr|A0A286SB96|A0A286SB96_CUCSA (Protein TIC 214 OS=Cucumis sativus var. hardwickii OX=319220 GN=ycf1 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.6e-11 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. TrEMBL
Match: tr|A0A1P8C7U3|A0A1P8C7U3_9ROSI (Protein TIC 214 OS=Cucumis x hytivus OX=442738 GN=ycf1 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.6e-11 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of MELO3C030661.2 vs. TrEMBL
Match: tr|A0A1D0CFN3|A0A1D0CFN3_9FABA (Protein TIC 214 OS=Acacia woodmaniorum OX=672358 GN=ycf1 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.1e-11 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |