MELO3C016036.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGAGGAAATAGAGGTGGTTGATAGAGCTTGGAAAGATGGAATTCTTCACTTGATTGGACAAGATGAGATTGTGGCAAGTAAAGTGTCAGTGCTAGCAAAAAGGGTTTTGATCAATTACGTTTATGATGCATTAAGGAGAAATTTAAGACAAAATGAAGAGGTCTTTTACATCCCTAGACAACGTATGCTCAAAGTGGAAATGACTTATGAGCTTTAG ATGGAAGAGGAAATAGAGGTGGTTGATAGAGCTTGGAAAGATGGAATTCTTCACTTGATTGGACAAGATGAGATTGTGGCAAGTAAAGTGTCAGTGCTAGCAAAAAGGGTTTTGATCAATTACGTTTATGATGCATTAAGGAGAAATTTAAGACAAAATGAAGAGGTCTTTTACATCCCTAGACAACGTATGCTCAAAGTGGAAATGACTTATGAGCTTTAG ATGGAAGAGGAAATAGAGGTGGTTGATAGAGCTTGGAAAGATGGAATTCTTCACTTGATTGGACAAGATGAGATTGTGGCAAGTAAAGTGTCAGTGCTAGCAAAAAGGGTTTTGATCAATTACGTTTATGATGCATTAAGGAGAAATTTAAGACAAAATGAAGAGGTCTTTTACATCCCTAGACAACGTATGCTCAAAGTGGAAATGACTTATGAGCTTTAG MEEEIEVVDRAWKDGILHLIGQDEIVASKVSVLAKRVLINYVYDALRRNLRQNEEVFYIPRQRMLKVEMTYEL
BLAST of MELO3C016036.2 vs. NCBI nr
Match: XP_022144450.1 (potassium transporter 5-like [Momordica charantia]) HSP 1 Score: 120.6 bits (301), Expect = 2.3e-24 Identity = 60/73 (82.19%), Postives = 67/73 (91.78%), Query Frame = 0
BLAST of MELO3C016036.2 vs. NCBI nr
Match: XP_004136047.1 (PREDICTED: potassium transporter 5-like [Cucumis sativus] >KGN44908.1 hypothetical protein Csa_7G395260 [Cucumis sativus]) HSP 1 Score: 120.2 bits (300), Expect = 3.0e-24 Identity = 61/71 (85.92%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of MELO3C016036.2 vs. NCBI nr
Match: XP_008451612.1 (PREDICTED: potassium transporter 5-like [Cucumis melo]) HSP 1 Score: 119.0 bits (297), Expect = 6.7e-24 Identity = 60/71 (84.51%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of MELO3C016036.2 vs. NCBI nr
Match: XP_004136176.1 (PREDICTED: potassium transporter 5-like [Cucumis sativus] >KGN44911.1 hypothetical protein Csa_7G395780 [Cucumis sativus]) HSP 1 Score: 117.9 bits (294), Expect = 1.5e-23 Identity = 62/69 (89.86%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of MELO3C016036.2 vs. NCBI nr
Match: XP_022959570.1 (potassium transporter 5-like [Cucurbita moschata]) HSP 1 Score: 117.9 bits (294), Expect = 1.5e-23 Identity = 59/73 (80.82%), Postives = 68/73 (93.15%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TAIR10
Match: AT4G13420.1 (high affinity K+ transporter 5) HSP 1 Score: 67.0 bits (162), Expect = 5.5e-12 Identity = 30/73 (41.10%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TAIR10
Match: AT4G33530.1 (K+ uptake permease 5) HSP 1 Score: 51.2 bits (121), Expect = 3.1e-07 Identity = 24/71 (33.80%), Postives = 46/71 (64.79%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TAIR10
Match: AT5G09400.1 (K+ uptake permease 7) HSP 1 Score: 50.8 bits (120), Expect = 4.0e-07 Identity = 24/71 (33.80%), Postives = 44/71 (61.97%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TAIR10
Match: AT1G60160.1 (Potassium transporter family protein) HSP 1 Score: 46.2 bits (108), Expect = 1.0e-05 Identity = 23/71 (32.39%), Postives = 38/71 (53.52%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TAIR10
Match: AT1G31120.1 (K+ uptake permease 10) HSP 1 Score: 45.4 bits (106), Expect = 1.7e-05 Identity = 20/65 (30.77%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of MELO3C016036.2 vs. Swiss-Prot
Match: sp|Q9M7K4|POT5_ARATH (Potassium transporter 5 OS=Arabidopsis thaliana OX=3702 GN=POT5 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 9.8e-11 Identity = 30/73 (41.10%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of MELO3C016036.2 vs. Swiss-Prot
Match: sp|Q84MS3|HAK16_ORYSJ (Probable potassium transporter 16 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK16 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.7e-10 Identity = 28/73 (38.36%), Postives = 56/73 (76.71%), Query Frame = 0
BLAST of MELO3C016036.2 vs. Swiss-Prot
Match: sp|Q6H4M2|HAK19_ORYSJ (Potassium transporter 19 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK19 PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.4e-09 Identity = 28/72 (38.89%), Postives = 50/72 (69.44%), Query Frame = 0
BLAST of MELO3C016036.2 vs. Swiss-Prot
Match: sp|Q84MS4|HAK27_ORYSJ (Potassium transporter 27 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK27 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.4e-09 Identity = 26/73 (35.62%), Postives = 52/73 (71.23%), Query Frame = 0
BLAST of MELO3C016036.2 vs. Swiss-Prot
Match: sp|Q5JK32|HAK5_ORYSJ (Potassium transporter 5 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK5 PE=2 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 2.4e-09 Identity = 25/71 (35.21%), Postives = 50/71 (70.42%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TrEMBL
Match: tr|A0A0A0K5Z5|A0A0A0K5Z5_CUCSA (Potassium transporter OS=Cucumis sativus OX=3659 GN=Csa_7G395260 PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 2.0e-24 Identity = 61/71 (85.92%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TrEMBL
Match: tr|A0A1S3BRV9|A0A1S3BRV9_CUCME (Potassium transporter OS=Cucumis melo OX=3656 GN=LOC103492847 PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 4.4e-24 Identity = 60/71 (84.51%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TrEMBL
Match: tr|A0A0A0KAT8|A0A0A0KAT8_CUCSA (Potassium transporter OS=Cucumis sativus OX=3659 GN=Csa_7G395780 PE=3 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 9.8e-24 Identity = 62/69 (89.86%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TrEMBL
Match: tr|A0A2R6P6G1|A0A2R6P6G1_ACTCH (Potassium transporter like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc31674 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.8e-17 Identity = 44/73 (60.27%), Postives = 63/73 (86.30%), Query Frame = 0
BLAST of MELO3C016036.2 vs. TrEMBL
Match: tr|A0A2R6QDT0|A0A2R6QDT0_ACTCH (Potassium transporter OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc19637 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 5.2e-17 Identity = 43/73 (58.90%), Postives = 61/73 (83.56%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|