MELO3C024199.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGATTATTACTACCCCAACTACCAAATCATCAAATATGAAAGCAAATAGTACATGTTTCTTTTTTGCAAATTATGCTTGGGCACTTGAGTATTATTACTCGATTACCATAATCAATAAAGGCTATGAGAGAAGCTTCTCCAAGATTCAAGAGGCTTTCACCAGTATGGATCTCTCAAGCAACAGATTTGAAGGCGAAATCCCAGATGAAATTGGCGAATTAAAGGGTCTACATTCTCTCGGTCTGTCTCACAATACACTTAGTGGTCGAATCCTACCGTCTTTAGGGAACATAACACAGCTTGAATCTTTGGATCTTTCAAACAGCAAGCTTTCAGGGGAGATTCCAGAAACATTGGCTCAGCTCACTTTCCTTCCAACTTTTACTGTTCCCAAAATAAACTCTTGGGTCTAA ATGAAGATTATTACTACCCCAACTACCAAATCATCAAATATGAAAGCAAATAGTACATGTTTCTTTTTTGCAAATTATGCTTGGGCACTTGAGTATTATTACTCGATTACCATAATCAATAAAGGCTATGAGAGAAGCTTCTCCAAGATTCAAGAGGCTTTCACCAGTATGGATCTCTCAAGCAACAGATTTGAAGGCGAAATCCCAGATGAAATTGGCGAATTAAAGGGTCTACATTCTCTCGGTCTGTCTCACAATACACTTAGTGGTCGAATCCTACCGTCTTTAGGGAACATAACACAGCTTGAATCTTTGGATCTTTCAAACAGCAAGCTTTCAGGGGAGATTCCAGAAACATTGGCTCAGCTCACTTTCCTTCCAACTTTTACTGTTCCCAAAATAAACTCTTGGGTCTAA ATGAAGATTATTACTACCCCAACTACCAAATCATCAAATATGAAAGCAAATAGTACATGTTTCTTTTTTGCAAATTATGCTTGGGCACTTGAGTATTATTACTCGATTACCATAATCAATAAAGGCTATGAGAGAAGCTTCTCCAAGATTCAAGAGGCTTTCACCAGTATGGATCTCTCAAGCAACAGATTTGAAGGCGAAATCCCAGATGAAATTGGCGAATTAAAGGGTCTACATTCTCTCGGTCTGTCTCACAATACACTTAGTGGTCGAATCCTACCGTCTTTAGGGAACATAACACAGCTTGAATCTTTGGATCTTTCAAACAGCAAGCTTTCAGGGGAGATTCCAGAAACATTGGCTCAGCTCACTTTCCTTCCAACTTTTACTGTTCCCAAAATAAACTCTTGGGTCTAA MKIITTPTTKSSNMKANSTCFFFANYAWALEYYYSITIINKGYERSFSKIQEAFTSMDLSSNRFEGEIPDEIGELKGLHSLGLSHNTLSGRILPSLGNITQLESLDLSNSKLSGEIPETLAQLTFLPTFTVPKINSWV
BLAST of MELO3C024199.2.1 vs. NCBI nr
Match: XP_022953006.1 (receptor-like protein 12 [Cucurbita moschata]) HSP 1 Score: 140.6 bits (353), Expect = 4.0e-30 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. NCBI nr
Match: XP_022968886.1 (receptor-like protein 12 [Cucurbita maxima]) HSP 1 Score: 140.6 bits (353), Expect = 4.0e-30 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. NCBI nr
Match: XP_023511641.1 (receptor-like protein 12 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 139.0 bits (349), Expect = 1.2e-29 Identity = 68/74 (91.89%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. NCBI nr
Match: XP_022136194.1 (receptor-like protein 12 [Momordica charantia]) HSP 1 Score: 84.0 bits (206), Expect = 4.5e-13 Identity = 39/61 (63.93%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. NCBI nr
Match: XP_022952370.1 (receptor-like protein 12 [Cucurbita moschata]) HSP 1 Score: 79.3 bits (194), Expect = 1.1e-11 Identity = 40/75 (53.33%), Postives = 53/75 (70.67%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TAIR10
Match: AT3G11010.1 (receptor like protein 34) HSP 1 Score: 47.0 bits (110), Expect = 1.1e-05 Identity = 23/52 (44.23%), Postives = 32/52 (61.54%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TAIR10
Match: AT1G71390.1 (receptor like protein 11) HSP 1 Score: 46.6 bits (109), Expect = 1.4e-05 Identity = 20/41 (48.78%), Postives = 29/41 (70.73%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TAIR10
Match: AT2G15080.1 (receptor like protein 19) HSP 1 Score: 46.2 bits (108), Expect = 1.9e-05 Identity = 21/52 (40.38%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TAIR10
Match: AT5G40170.1 (receptor like protein 54) HSP 1 Score: 46.2 bits (108), Expect = 1.9e-05 Identity = 24/55 (43.64%), Postives = 32/55 (58.18%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TAIR10
Match: AT3G28890.1 (receptor like protein 43) HSP 1 Score: 45.8 bits (107), Expect = 2.5e-05 Identity = 21/49 (42.86%), Postives = 31/49 (63.27%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. Swiss-Prot
Match: sp|Q9SRL2|RLP34_ARATH (Receptor-like protein 34 OS=Arabidopsis thaliana OX=3702 GN=RLP34 PE=2 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 2.0e-04 Identity = 23/52 (44.23%), Postives = 32/52 (61.54%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. Swiss-Prot
Match: sp|Q9C9H6|RLP11_ARATH (Receptor-like protein 11 OS=Arabidopsis thaliana OX=3702 GN=RLP11 PE=3 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 2.6e-04 Identity = 20/41 (48.78%), Postives = 29/41 (70.73%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. Swiss-Prot
Match: sp|Q9ZUK3|RLP19_ARATH (Receptor-like protein 19 OS=Arabidopsis thaliana OX=3702 GN=RLP19 PE=2 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 3.4e-04 Identity = 21/52 (40.38%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. Swiss-Prot
Match: sp|F4KHA2|RLP54_ARATH (Receptor-like protein 54 OS=Arabidopsis thaliana OX=3702 GN=RLP54 PE=3 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 3.4e-04 Identity = 24/55 (43.64%), Postives = 32/55 (58.18%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. Swiss-Prot
Match: sp|Q9LJW7|RLP43_ARATH (Receptor-like protein 43 OS=Arabidopsis thaliana OX=3702 GN=RLP43 PE=2 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 4.4e-04 Identity = 21/49 (42.86%), Postives = 31/49 (63.27%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TrEMBL
Match: tr|A0A0A0LDU4|A0A0A0LDU4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G881780 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 5.2e-10 Identity = 39/78 (50.00%), Postives = 53/78 (67.95%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TrEMBL
Match: tr|A0A1S3CQX8|A0A1S3CQX8_CUCME (receptor-like protein 12 OS=Cucumis melo OX=3656 GN=LOC103503759 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 9.9e-09 Identity = 37/76 (48.68%), Postives = 51/76 (67.11%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TrEMBL
Match: tr|A0A2P6SFB7|A0A2P6SFB7_ROSCH (Putative leucine-rich repeat-containing, plant-type, leucine-rich repeat domain, L OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0347571 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 2.9e-08 Identity = 37/69 (53.62%), Postives = 50/69 (72.46%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TrEMBL
Match: tr|A0A2P5C2U0|A0A2P5C2U0_PARAD (Leucine-rich repeat domain containing protein OS=Parasponia andersonii OX=3476 GN=PanWU01x14_188870 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 3.8e-08 Identity = 29/51 (56.86%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of MELO3C024199.2.1 vs. TrEMBL
Match: tr|A0A061F959|A0A061F959_THECC (Brassinosteroid insensitive 1, putative OS=Theobroma cacao OX=3641 GN=TCM_032007 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 6.4e-08 Identity = 29/54 (53.70%), Postives = 38/54 (70.37%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|