Lsi09G017820.1 (mRNA) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGAAATTAAAAGTTGGGGCGGAGAGCGTTGGAGAGAAAGAGGAGAAATGGGTGAAGAGTATAAGCAATCACTTGGGACGCCAAGTTTGGGAGTTTTGTGCCGATTCAGCAGCCACAGCTACTCCAAAGCACTTACAACAAATTCAGAATGCAAGGAAGCACTTTCGTAATAATCGTTTCCACCGAAAGCAATCTTCCGATCTCTTTCTTGCTATTCAGGTCTTTTAA ATGTGGAAATTAAAAGTTGGGGCGGAGAGCGTTGGAGAGAAAGAGGAGAAATGGGTGAAGAGTATAAGCAATCACTTGGGACGCCAAGTTTGGGAGTTTTGTGCCGATTCAGCAGCCACAGCTACTCCAAAGCACTTACAACAAATTCAGAATGCAAGGAAGCACTTTCGTAATAATCGTTTCCACCGAAAGCAATCTTCCGATCTCTTTCTTGCTATTCAGGTCTTTTAA ATGTGGAAATTAAAAGTTGGGGCGGAGAGCGTTGGAGAGAAAGAGGAGAAATGGGTGAAGAGTATAAGCAATCACTTGGGACGCCAAGTTTGGGAGTTTTGTGCCGATTCAGCAGCCACAGCTACTCCAAAGCACTTACAACAAATTCAGAATGCAAGGAAGCACTTTCGTAATAATCGTTTCCACCGAAAGCAATCTTCCGATCTCTTTCTTGCTATTCAGGTCTTTTAA MWKLKVGAESVGEKEEKWVKSISNHLGRQVWEFCADSAATATPKHLQQIQNARKHFRNNRFHRKQSSDLFLAIQVF
BLAST of Lsi09G017820.1 vs. Swiss-Prot
Match: CUCS_CUCPE (Cucurbitadienol synthase OS=Cucurbita pepo GN=CPQ PE=1 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 8.2e-29 Identity = 61/74 (82.43%), Postives = 67/74 (90.54%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. Swiss-Prot
Match: CAS1_BETPL (Cycloartenol synthase OS=Betula platyphylla GN=CASBPX1 PE=1 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 6.3e-13 Identity = 38/80 (47.50%), Postives = 51/80 (63.75%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. Swiss-Prot
Match: CAS1_CUCPE (Cycloartenol synthase OS=Cucurbita pepo GN=CPX PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 9.1e-12 Identity = 33/77 (42.86%), Postives = 52/77 (67.53%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. Swiss-Prot
Match: CAS1_RICCO (Cycloartenol synthase OS=Ricinus communis PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-11 Identity = 36/74 (48.65%), Postives = 51/74 (68.92%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. Swiss-Prot
Match: CAS1_LUFAE (Cycloartenol synthase OS=Luffa aegyptiaca GN=CAS1 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-11 Identity = 34/77 (44.16%), Postives = 52/77 (67.53%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TrEMBL
Match: A0A0D3QXV2_9ROSI (Terpene cyclase/mutase family member OS=Citrullus colocynthis GN=CDS2 PE=2 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 6.8e-30 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TrEMBL
Match: A0A0D3QY32_9ROSI (Terpene cyclase/mutase family member OS=Citrullus colocynthis GN=CDS1 PE=2 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.7e-28 Identity = 64/74 (86.49%), Postives = 67/74 (90.54%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TrEMBL
Match: A0A097IYL3_CUCSA (Terpene cyclase/mutase family member OS=Cucumis sativus GN=Csa6G088690 PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 5.2e-22 Identity = 58/92 (63.04%), Postives = 64/92 (69.57%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TrEMBL
Match: K7NBZ9_SIRGR (Terpene cyclase/mutase family member OS=Siraitia grosvenorii PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 7.5e-21 Identity = 51/74 (68.92%), Postives = 60/74 (81.08%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TrEMBL
Match: M5XAU4_PRUPE (Terpene cyclase/mutase family member OS=Prunus persica GN=PRUPE_ppa001806mg PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.2e-15 Identity = 43/74 (58.11%), Postives = 57/74 (77.03%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TAIR10
Match: AT2G07050.1 (AT2G07050.1 cycloartenol synthase 1) HSP 1 Score: 59.3 bits (142), Expect = 1.2e-09 Identity = 30/74 (40.54%), Postives = 45/74 (60.81%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TAIR10
Match: AT4G15340.1 (AT4G15340.1 pentacyclic triterpene synthase 1) HSP 1 Score: 57.0 bits (136), Expect = 5.9e-09 Identity = 27/74 (36.49%), Postives = 50/74 (67.57%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TAIR10
Match: AT1G78955.1 (AT1G78955.1 camelliol C synthase 1) HSP 1 Score: 55.8 bits (133), Expect = 1.3e-08 Identity = 32/74 (43.24%), Postives = 44/74 (59.46%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TAIR10
Match: AT1G78950.1 (AT1G78950.1 Terpenoid cyclases family protein) HSP 1 Score: 51.6 bits (122), Expect = 2.5e-07 Identity = 28/74 (37.84%), Postives = 42/74 (56.76%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. TAIR10
Match: AT5G36150.1 (AT5G36150.1 putative pentacyclic triterpene synthase 3) HSP 1 Score: 50.8 bits (120), Expect = 4.2e-07 Identity = 26/74 (35.14%), Postives = 46/74 (62.16%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. NCBI nr
Match: gi|764145351|gb|AJR21210.1| (cucurbitadienol synthase 2 [Citrullus colocynthis]) HSP 1 Score: 137.5 bits (345), Expect = 9.7e-30 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. NCBI nr
Match: gi|764145349|gb|AJR21209.1| (cucurbitadienol synthase 1 [Citrullus colocynthis]) HSP 1 Score: 132.9 bits (333), Expect = 2.4e-28 Identity = 64/74 (86.49%), Postives = 67/74 (90.54%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. NCBI nr
Match: gi|75254648|sp|Q6BE24.1|CUCS_CUCPE (RecName: Full=Cucurbitadienol synthase) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 61/74 (82.43%), Postives = 67/74 (90.54%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. NCBI nr
Match: gi|659119965|ref|XP_008459938.1| (PREDICTED: cucurbitadienol synthase [Cucumis melo]) HSP 1 Score: 115.5 bits (288), Expect = 3.9e-23 Identity = 56/81 (69.14%), Postives = 61/81 (75.31%), Query Frame = 1
BLAST of Lsi09G017820.1 vs. NCBI nr
Match: gi|793420273|ref|NP_001292630.1| (cucurbitadienol synthase [Cucumis sativus]) HSP 1 Score: 111.3 bits (277), Expect = 7.4e-22 Identity = 58/92 (63.04%), Postives = 64/92 (69.57%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
|