CmaCh19G006720 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCAATGTCCGCTCATGGGTCGGGTGTATGGACTGCAAAGCAAAACAAGGCGTTTGAAGAGGCTTTGGCAATGTATGATCAAGACAGACCTGATCGATGGCTGAATGTTGCTAAGGCCATTGGTGGAAAAACTGAAGAGGAAGTGAAAAGGCATTACCAAGTTCTTGTGGAGGATGTTAAGCATATTGAGTCTGGCAAGGTTCCTTTTCCTTATCGAAGCTCAAGAGGAAGTTAA ATGGCTTCAATGTCCGCTCATGGGTCGGGTGTATGGACTGCAAAGCAAAACAAGGCGTTTGAAGAGGCTTTGGCAATGTATGATCAAGACAGACCTGATCGATGGCTGAATGTTGCTAAGGCCATTGGTGGAAAAACTGAAGAGGAAGTGAAAAGGCATTACCAAGTTCTTGTGGAGGATGTTAAGCATATTGAGTCTGGCAAGGTTCCTTTTCCTTATCGAAGCTCAAGAGGAAGTTAA ATGGCTTCAATGTCCGCTCATGGGTCGGGTGTATGGACTGCAAAGCAAAACAAGGCGTTTGAAGAGGCTTTGGCAATGTATGATCAAGACAGACCTGATCGATGGCTGAATGTTGCTAAGGCCATTGGTGGAAAAACTGAAGAGGAAGTGAAAAGGCATTACCAAGTTCTTGTGGAGGATGTTAAGCATATTGAGTCTGGCAAGGTTCCTTTTCCTTATCGAAGCTCAAGAGGAAGTTAA MASMSAHGSGVWTAKQNKAFEEALAMYDQDRPDRWLNVAKAIGGKTEEEVKRHYQVLVEDVKHIESGKVPFPYRSSRGS
BLAST of CmaCh19G006720 vs. Swiss-Prot
Match: RADL1_ARATH (Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 3.4e-25 Identity = 54/78 (69.23%), Postives = 65/78 (83.33%), Query Frame = 1
BLAST of CmaCh19G006720 vs. Swiss-Prot
Match: RADL2_ARATH (Protein RADIALIS-like 2 OS=Arabidopsis thaliana GN=RL2 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 6.3e-24 Identity = 51/78 (65.38%), Postives = 64/78 (82.05%), Query Frame = 1
BLAST of CmaCh19G006720 vs. Swiss-Prot
Match: RAD_ANTMA (Transcription factor RADIALIS OS=Antirrhinum majus GN=RAD PE=1 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.4e-23 Identity = 51/77 (66.23%), Postives = 66/77 (85.71%), Query Frame = 1
BLAST of CmaCh19G006720 vs. Swiss-Prot
Match: RADL3_ARATH (Protein RADIALIS-like 3 OS=Arabidopsis thaliana GN=RL3 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.0e-21 Identity = 47/79 (59.49%), Postives = 57/79 (72.15%), Query Frame = 1
BLAST of CmaCh19G006720 vs. Swiss-Prot
Match: RADL6_ARATH (Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-20 Identity = 47/72 (65.28%), Postives = 55/72 (76.39%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TrEMBL
Match: A0A0A0K344_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G169070 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.2e-34 Identity = 72/79 (91.14%), Postives = 77/79 (97.47%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TrEMBL
Match: A0A0A0K348_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G170600 PE=4 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 2.7e-29 Identity = 63/78 (80.77%), Postives = 70/78 (89.74%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TrEMBL
Match: A0A0A0K3K0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G168060 PE=4 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 5.9e-29 Identity = 62/79 (78.48%), Postives = 71/79 (89.87%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TrEMBL
Match: A0A061E040_THECC (Homeodomain-like superfamily protein OS=Theobroma cacao GN=TCM_006883 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.1e-26 Identity = 59/79 (74.68%), Postives = 70/79 (88.61%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TrEMBL
Match: A0A0D2W2J5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G036700 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 4.7e-26 Identity = 57/75 (76.00%), Postives = 67/75 (89.33%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TAIR10
Match: AT4G39250.1 (AT4G39250.1 RAD-like 1) HSP 1 Score: 115.2 bits (287), Expect = 1.9e-26 Identity = 54/78 (69.23%), Postives = 65/78 (83.33%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TAIR10
Match: AT2G21650.1 (AT2G21650.1 Homeodomain-like superfamily protein) HSP 1 Score: 110.9 bits (276), Expect = 3.6e-25 Identity = 51/78 (65.38%), Postives = 64/78 (82.05%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TAIR10
Match: AT1G75250.1 (AT1G75250.1 RAD-like 6) HSP 1 Score: 100.1 bits (248), Expect = 6.3e-22 Identity = 47/72 (65.28%), Postives = 55/72 (76.39%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TAIR10
Match: AT1G19510.1 (AT1G19510.1 RAD-like 5) HSP 1 Score: 99.0 bits (245), Expect = 1.4e-21 Identity = 46/72 (63.89%), Postives = 54/72 (75.00%), Query Frame = 1
BLAST of CmaCh19G006720 vs. TAIR10
Match: AT2G18328.1 (AT2G18328.1 RAD-like 4) HSP 1 Score: 87.4 bits (215), Expect = 4.2e-18 Identity = 43/77 (55.84%), Postives = 58/77 (75.32%), Query Frame = 1
BLAST of CmaCh19G006720 vs. NCBI nr
Match: gi|659092351|ref|XP_008447025.1| (PREDICTED: protein RADIALIS-like 1 [Cucumis melo]) HSP 1 Score: 154.1 bits (388), Expect = 1.0e-34 Identity = 72/79 (91.14%), Postives = 78/79 (98.73%), Query Frame = 1
BLAST of CmaCh19G006720 vs. NCBI nr
Match: gi|449466805|ref|XP_004151116.1| (PREDICTED: protein RADIALIS-like 1 [Cucumis sativus]) HSP 1 Score: 153.3 bits (386), Expect = 1.8e-34 Identity = 72/79 (91.14%), Postives = 77/79 (97.47%), Query Frame = 1
BLAST of CmaCh19G006720 vs. NCBI nr
Match: gi|659092346|ref|XP_008447024.1| (PREDICTED: protein RADIALIS-like 1 [Cucumis melo]) HSP 1 Score: 136.3 bits (342), Expect = 2.2e-29 Identity = 63/76 (82.89%), Postives = 70/76 (92.11%), Query Frame = 1
BLAST of CmaCh19G006720 vs. NCBI nr
Match: gi|778725458|ref|XP_004151125.2| (PREDICTED: protein RADIALIS-like 1 [Cucumis sativus]) HSP 1 Score: 135.6 bits (340), Expect = 3.8e-29 Identity = 63/78 (80.77%), Postives = 70/78 (89.74%), Query Frame = 1
BLAST of CmaCh19G006720 vs. NCBI nr
Match: gi|778725452|ref|XP_011658943.1| (PREDICTED: protein RADIALIS-like 1 [Cucumis sativus]) HSP 1 Score: 134.4 bits (337), Expect = 8.5e-29 Identity = 62/79 (78.48%), Postives = 71/79 (89.87%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|