Cucsa.242220.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGATAACCTCCGCCACCGCAAGGAATCATTCGCAATTGCGAGGGCCAAGGCCACCGCCATTGACGGTTAACAAATCCAGCTCCACTAACATTTCCAAGAAATCAACGAAGAATAATCCTCTTCCGATTTCGAATCAACGCCATCGCCGTTCTCCGATAATCATTTACCTTCGATCCCCAAAGGTCATCCATGTTCGGCCTGAGGAGTTCAAAAGCTTCGTTCAACGTCTCACTGGAAATCGATCCTCTGTAGCCGTCGTCGCCTCATCCTGTTCTGCTACTGGAATGATTAATGATGAGGAATTTGTATCC ATGATGATAACCTCCGCCACCGCAAGGAATCATTCGCAATTGCGAGGGCCAAGGCCACCGCCATTGACGGTTAACAAATCCAGCTCCACTAACATTTCCAAGAAATCAACGAAGAATAATCCTCTTCCGATTTCGAATCAACGCCATCGCCGTTCTCCGATAATCATTTACCTTCGATCCCCAAAGGTCATCCATGTTCGGCCTGAGGAGTTCAAAAGCTTCGTTCAACGTCTCACTGGAAATCGATCCTCTGTAGCCGTCGTCGCCTCATCCTGTTCTGCTACTGGAATGATTAATGATGAGGAATTTGTATCC ATGATGATAACCTCCGCCACCGCAAGGAATCATTCGCAATTGCGAGGGCCAAGGCCACCGCCATTGACGGTTAACAAATCCAGCTCCACTAACATTTCCAAGAAATCAACGAAGAATAATCCTCTTCCGATTTCGAATCAACGCCATCGCCGTTCTCCGATAATCATTTACCTTCGATCCCCAAAGGTCATCCATGTTCGGCCTGAGGAGTTCAAAAGCTTCGTTCAACGTCTCACTGGAAATCGATCCTCTGTAGCCGTCGTCGCCTCATCCTGTTCTGCTACTGGAATGATTAATGATGAGGAATTTGTATCC MMITSATARNHSQLRGPRPPPLTVNKSSSTNISKKSTKNNPLPISNQRHRRSPIIIYLRSPKVIHVRPEEFKSFVQRLTGNRSSVAVVASSCSATGMINDEEFVS
BLAST of Cucsa.242220.1 vs. Swiss-Prot
Match: VQ8_ARATH (VQ motif-containing protein 8, chloroplastic OS=Arabidopsis thaliana GN=VQ8 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.9e-07 Identity = 31/69 (44.93%), Postives = 39/69 (56.52%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. Swiss-Prot
Match: MKS1_ARATH (Protein MKS1 OS=Arabidopsis thaliana GN=MKS1 PE=1 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 3.2e-07 Identity = 33/78 (42.31%), Postives = 42/78 (53.85%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. Swiss-Prot
Match: NSRB_ARATH (Nuclear speckle RNA-binding protein B OS=Arabidopsis thaliana GN=NSRB PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.7e-06 Identity = 33/95 (34.74%), Postives = 45/95 (47.37%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. Swiss-Prot
Match: VQ20_ARATH (VQ motif-containing protein 20 OS=Arabidopsis thaliana GN=VQ20 PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.7e-06 Identity = 27/64 (42.19%), Postives = 39/64 (60.94%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TrEMBL
Match: A0A0A0LEW5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G785410 PE=4 SV=1) HSP 1 Score: 206.8 bits (525), Expect = 1.3e-50 Identity = 104/105 (99.05%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TrEMBL
Match: B9SDN3_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0422690 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.0e-12 Identity = 49/100 (49.00%), Postives = 63/100 (63.00%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TrEMBL
Match: A0A0B2SA13_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_002174 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.1e-11 Identity = 42/89 (47.19%), Postives = 56/89 (62.92%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TrEMBL
Match: I1NAX0_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_19G202300 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.1e-11 Identity = 42/89 (47.19%), Postives = 56/89 (62.92%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TrEMBL
Match: A0A0D2QB25_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G233400 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.5e-11 Identity = 43/86 (50.00%), Postives = 56/86 (65.12%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TAIR10
Match: AT1G68450.1 (AT1G68450.1 VQ motif-containing protein) HSP 1 Score: 56.6 bits (135), Expect = 1.1e-08 Identity = 31/69 (44.93%), Postives = 39/69 (56.52%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TAIR10
Match: AT3G18690.1 (AT3G18690.1 MAP kinase substrate 1) HSP 1 Score: 55.8 bits (133), Expect = 1.8e-08 Identity = 33/78 (42.31%), Postives = 42/78 (53.85%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TAIR10
Match: AT1G21326.1 (AT1G21326.1 VQ motif-containing protein) HSP 1 Score: 55.1 bits (131), Expect = 3.1e-08 Identity = 35/95 (36.84%), Postives = 45/95 (47.37%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TAIR10
Match: AT1G21320.1 (AT1G21320.1 nucleotide binding;nucleic acid binding) HSP 1 Score: 52.8 bits (125), Expect = 1.5e-07 Identity = 33/95 (34.74%), Postives = 45/95 (47.37%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. TAIR10
Match: AT3G18360.1 (AT3G18360.1 VQ motif-containing protein) HSP 1 Score: 52.8 bits (125), Expect = 1.5e-07 Identity = 27/64 (42.19%), Postives = 39/64 (60.94%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. NCBI nr
Match: gi|700204114|gb|KGN59247.1| (hypothetical protein Csa_3G785410 [Cucumis sativus]) HSP 1 Score: 206.8 bits (525), Expect = 1.8e-50 Identity = 104/105 (99.05%), Postives = 104/105 (99.05%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. NCBI nr
Match: gi|659085780|ref|XP_008443599.1| (PREDICTED: protein MKS1-like [Cucumis melo]) HSP 1 Score: 152.1 bits (383), Expect = 5.3e-34 Identity = 84/101 (83.17%), Postives = 87/101 (86.14%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. NCBI nr
Match: gi|764620702|ref|XP_011468538.1| (PREDICTED: uncharacterized protein LOC105352670 [Fragaria vesca subsp. vesca]) HSP 1 Score: 82.4 bits (202), Expect = 5.1e-13 Identity = 46/98 (46.94%), Postives = 62/98 (63.27%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. NCBI nr
Match: gi|223536670|gb|EEF38312.1| (conserved hypothetical protein [Ricinus communis]) HSP 1 Score: 80.9 bits (198), Expect = 1.5e-12 Identity = 49/100 (49.00%), Postives = 63/100 (63.00%), Query Frame = 1
BLAST of Cucsa.242220.1 vs. NCBI nr
Match: gi|731398388|ref|XP_010653237.1| (PREDICTED: protein MKS1-like [Vitis vinifera]) HSP 1 Score: 80.5 bits (197), Expect = 1.9e-12 Identity = 42/83 (50.60%), Postives = 58/83 (69.88%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|