Cucsa.194280 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGTATGTAGTTTCATTCACCGTTAAGATTCTGCTATTTTTCCGAATGAATTTGATTATTGCTTCGGGCGTTTTTATCTAATTTGTGGATTCATAAAGTTTGTTCCTGTTATTTATATCTGCTAGTAATCAAAATATTTAATTGAGGTAGATTTAGAAGTATGTAGATGGTAGTaCTGGAGTTTTTTTAGGGTTAtAGTTTTtttAGGGTTTATGCTTGTTGGAGGCTTTGGTTGCTGATGGGTTTGTTGGCATTTATTGAATGTAGTTTTGTTGCTTTGTATGTACAACAAACTTTAGAGTGATGCGTTGAGAGAAGCCATTTCATCTATCTTTGTTGATAGCAGTGAAAAGAAGTGCAAATTCACTGAGACCATTGAACTTCATATTGGACCGAAGAACTATGATCCACAAAAGGACAAGCGTTTCAGTGGTTCAGTGAAGTTGTTACATATCCCTCGCCCTAAGATGAAGATGTGCATGCTTGGAGATGCTTCACACGTTGAAGAG ATGAGTGATGCGTTGAGAGAAGCCATTTCATCTATCTTTGTTGATAGCAGTGAAAAGAAGTGCAAATTCACTGAGACCATTGAACTTCATATTGGACCGAAGAACTATGATCCACAAAAGGACAAGCGTTTCAGTGGTTCAGTGAAGTTGTTACATATCCCTCGCCCTAAGATGAAGATGTGCATGCTTGGAGATGCTTCACACGTTGAAGAG ATGAGTGATGCGTTGAGAGAAGCCATTTCATCTATCTTTGTTGATAGCAGTGAAAAGAAGTGCAAATTCACTGAGACCATTGAACTTCATATTGGACCGAAGAACTATGATCCACAAAAGGACAAGCGTTTCAGTGGTTCAGTGAAGTTGTTACATATCCCTCGCCCTAAGATGAAGATGTGCATGCTTGGAGATGCTTCACACGTTGAAGAG MSDALREAISSIFVDSSEKKCKFTETIELHIGPKNYDPQKDKRFSGSVKLLHIPRPKMKMCMLGDASHVEE
BLAST of Cucsa.194280 vs. Swiss-Prot
Match: R10A_ORYSJ (60S ribosomal protein L10a OS=Oryza sativa subsp. japonica GN=RPL10A PE=1 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 9.7e-24 Identity = 53/70 (75.71%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of Cucsa.194280 vs. Swiss-Prot
Match: R10A_ORYSI (60S ribosomal protein L10a OS=Oryza sativa subsp. indica GN=RPL10A PE=3 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 9.7e-24 Identity = 53/70 (75.71%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of Cucsa.194280 vs. Swiss-Prot
Match: R10A2_ARATH (60S ribosomal protein L10a-2 OS=Arabidopsis thaliana GN=RPL10AB PE=1 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 3.7e-23 Identity = 53/70 (75.71%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of Cucsa.194280 vs. Swiss-Prot
Match: R10A1_ARATH (60S ribosomal protein L10a-1 OS=Arabidopsis thaliana GN=RPL10AA PE=1 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.1e-22 Identity = 53/70 (75.71%), Postives = 58/70 (82.86%), Query Frame = 1
BLAST of Cucsa.194280 vs. Swiss-Prot
Match: R10A3_ARATH (60S ribosomal protein L10a-3 OS=Arabidopsis thaliana GN=RPL10AC PE=1 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.1e-22 Identity = 54/71 (76.06%), Postives = 59/71 (83.10%), Query Frame = 1
BLAST of Cucsa.194280 vs. TrEMBL
Match: A0A0A0LVE6_CUCSA (Ribosomal protein OS=Cucumis sativus GN=Csa_1G163140 PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.5e-26 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 1
BLAST of Cucsa.194280 vs. TrEMBL
Match: A0A0A0M0B3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G629190 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.5e-26 Identity = 62/70 (88.57%), Postives = 64/70 (91.43%), Query Frame = 1
BLAST of Cucsa.194280 vs. TrEMBL
Match: A0A0A0KEW8_CUCSA (Ribosomal protein OS=Cucumis sativus GN=Csa_6G152330 PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.5e-26 Identity = 63/70 (90.00%), Postives = 64/70 (91.43%), Query Frame = 1
BLAST of Cucsa.194280 vs. TrEMBL
Match: A0A059D9G4_EUCGR (Ribosomal protein OS=Eucalyptus grandis GN=EUGRSUZ_B03850 PE=3 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 6.1e-25 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 1
BLAST of Cucsa.194280 vs. TrEMBL
Match: A0A059DAY2_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_B03850 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 6.1e-25 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 1
BLAST of Cucsa.194280 vs. TAIR10
Match: AT2G27530.1 (AT2G27530.1 Ribosomal protein L1p/L10e family) HSP 1 Score: 108.2 bits (269), Expect = 2.1e-24 Identity = 53/70 (75.71%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of Cucsa.194280 vs. TAIR10
Match: AT1G08360.1 (AT1G08360.1 Ribosomal protein L1p/L10e family) HSP 1 Score: 106.7 bits (265), Expect = 6.0e-24 Identity = 53/70 (75.71%), Postives = 58/70 (82.86%), Query Frame = 1
BLAST of Cucsa.194280 vs. TAIR10
Match: AT5G22440.1 (AT5G22440.1 Ribosomal protein L1p/L10e family) HSP 1 Score: 106.7 bits (265), Expect = 6.0e-24 Identity = 54/71 (76.06%), Postives = 59/71 (83.10%), Query Frame = 1
BLAST of Cucsa.194280 vs. NCBI nr
Match: gi|659117410|ref|XP_008458587.1| (PREDICTED: 60S ribosomal protein L10a-1-like [Cucumis melo]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 63/70 (90.00%), Postives = 64/70 (91.43%), Query Frame = 1
BLAST of Cucsa.194280 vs. NCBI nr
Match: gi|700211466|gb|KGN66562.1| (hypothetical protein Csa_1G629190 [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 62/70 (88.57%), Postives = 64/70 (91.43%), Query Frame = 1
BLAST of Cucsa.194280 vs. NCBI nr
Match: gi|659071695|ref|XP_008461453.1| (PREDICTED: 60S ribosomal protein L10a-1 [Cucumis melo]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 1
BLAST of Cucsa.194280 vs. NCBI nr
Match: gi|449443440|ref|XP_004139485.1| (PREDICTED: 60S ribosomal protein L10a-1 [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 1
BLAST of Cucsa.194280 vs. NCBI nr
Match: gi|629122880|gb|KCW87370.1| (hypothetical protein EUGRSUZ_B03850 [Eucalyptus grandis]) HSP 1 Score: 120.9 bits (302), Expect = 8.8e-25 Identity = 60/70 (85.71%), Postives = 62/70 (88.57%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|