Cucsa.182040 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAGAGAATTGGGAAAGTCTTCAACTACCAATAGCCAATGTTGAGAGAATAATGAAGAAGATAGTTCCAGAAAaGGGAAAGATTTCAAAAGAAGCCAAGAAGAGAATGCAAGAATGTGCGAATGAGTTCATTAACTTTGTCACAAGTGAAGCAGCACAAAGATGTCAGAATGAGAATAGAAGAACTCTCAATGGTGATGATATCTATTGGGCATTTGATTCTCTTGGCTTAGATAATTATGCTGAGGCTTCTTCCAAGTACCTGCTTAA ATGGGAGAGAATTGGGAAAGTCTTCAACTACCAATAGCCAATGTTGAGAGAATAATGAAGAAGATAGTTCCAGAAAAGGGAAAGATTTCAAAAGAAGCCAAGAAGAGAATGCAAGAATGTGCGAATGAGTTCATTAACTTTGTCACAAGTGAAGCAGCACAAAGATGTCAGAATGAGAATAGAAGAACTCTCAATGGTGATGATATCTATTGGGCATTTGATTCTCTTGGCTTAGATAATTATGCTGAGGCTTCTTCCAAGTACCTGCTTAA ATGGGAGAGAATTGGGAAAGTCTTCAACTACCAATAGCCAATGTTGAGAGAATAATGAAGAAGATAGTTCCAGAAAaGGGAAAGATTTCAAAAGAAGCCAAGAAGAGAATGCAAGAATGTGCGAATGAGTTCATTAACTTTGTCACAAGTGAAGCAGCACAAAGATGTCAGAATGAGAATAGAAGAACTCTCAATGGTGATGATATCTATTGGGCATTTGATTCTCTTGGCTTAGATAATTATGCTGAGGCTTCTTCCAAGTACCTGCTTAA MGENWESLQLPIANVERIMKKIVPEKGKISKEAKKRMQECANEFINFVTSEAAQRCQNENRRTLNGDDIYWAFDSLGLDNYAEASSKYLLX
BLAST of Cucsa.182040 vs. Swiss-Prot
Match: NFYB4_ARATH (Nuclear transcription factor Y subunit B-4 OS=Arabidopsis thaliana GN=NFYB4 PE=1 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 5.0e-25 Identity = 52/84 (61.90%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of Cucsa.182040 vs. Swiss-Prot
Match: NFYB5_ARATH (Nuclear transcription factor Y subunit B-5 OS=Arabidopsis thaliana GN=NFYB5 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.3e-22 Identity = 49/80 (61.25%), Postives = 60/80 (75.00%), Query Frame = 1
BLAST of Cucsa.182040 vs. Swiss-Prot
Match: NFYB3_ORYSJ (Nuclear transcription factor Y subunit B-3 OS=Oryza sativa subsp. japonica GN=NFYB3 PE=1 SV=2) HSP 1 Score: 105.1 bits (261), Expect = 4.0e-22 Identity = 45/80 (56.25%), Postives = 62/80 (77.50%), Query Frame = 1
BLAST of Cucsa.182040 vs. Swiss-Prot
Match: NFYB_MAIZE (Nuclear transcription factor Y subunit B OS=Zea mays GN=NFY2 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.0e-22 Identity = 45/80 (56.25%), Postives = 62/80 (77.50%), Query Frame = 1
BLAST of Cucsa.182040 vs. Swiss-Prot
Match: NFYB2_ARATH (Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana GN=NFYB2 PE=2 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.2e-22 Identity = 47/80 (58.75%), Postives = 60/80 (75.00%), Query Frame = 1
BLAST of Cucsa.182040 vs. TrEMBL
Match: A0A0A0LZ17_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G569530 PE=4 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 3.4e-44 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cucsa.182040 vs. TrEMBL
Match: A0A0A0LW12_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G569510 PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 1.2e-36 Identity = 77/85 (90.59%), Postives = 83/85 (97.65%), Query Frame = 1
BLAST of Cucsa.182040 vs. TrEMBL
Match: A0A022QI59_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a022187mg PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.0e-24 Identity = 57/82 (69.51%), Postives = 67/82 (81.71%), Query Frame = 1
BLAST of Cucsa.182040 vs. TrEMBL
Match: M5WPU4_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa021948mg PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 3.0e-24 Identity = 53/80 (66.25%), Postives = 69/80 (86.25%), Query Frame = 1
BLAST of Cucsa.182040 vs. TrEMBL
Match: M1CB00_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400024745 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.1e-23 Identity = 55/80 (68.75%), Postives = 65/80 (81.25%), Query Frame = 1
BLAST of Cucsa.182040 vs. TAIR10
Match: AT1G09030.1 (AT1G09030.1 nuclear factor Y, subunit B4) HSP 1 Score: 114.8 bits (286), Expect = 2.8e-26 Identity = 52/84 (61.90%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of Cucsa.182040 vs. TAIR10
Match: AT2G47810.1 (AT2G47810.1 nuclear factor Y, subunit B5) HSP 1 Score: 105.9 bits (263), Expect = 1.3e-23 Identity = 49/80 (61.25%), Postives = 60/80 (75.00%), Query Frame = 1
BLAST of Cucsa.182040 vs. TAIR10
Match: AT5G47640.1 (AT5G47640.1 nuclear factor Y, subunit B2) HSP 1 Score: 104.8 bits (260), Expect = 2.9e-23 Identity = 47/80 (58.75%), Postives = 60/80 (75.00%), Query Frame = 1
BLAST of Cucsa.182040 vs. TAIR10
Match: AT2G13570.1 (AT2G13570.1 nuclear factor Y, subunit B7) HSP 1 Score: 104.4 bits (259), Expect = 3.8e-23 Identity = 47/80 (58.75%), Postives = 61/80 (76.25%), Query Frame = 1
BLAST of Cucsa.182040 vs. TAIR10
Match: AT3G53340.1 (AT3G53340.1 nuclear factor Y, subunit B10) HSP 1 Score: 102.8 bits (255), Expect = 1.1e-22 Identity = 45/81 (55.56%), Postives = 63/81 (77.78%), Query Frame = 1
BLAST of Cucsa.182040 vs. NCBI nr
Match: gi|449435998|ref|XP_004135781.1| (PREDICTED: nuclear transcription factor Y subunit B-4-like [Cucumis sativus]) HSP 1 Score: 185.3 bits (469), Expect = 4.9e-44 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cucsa.182040 vs. NCBI nr
Match: gi|659100539|ref|XP_008451143.1| (PREDICTED: beta-galactosidase 15-like [Cucumis melo]) HSP 1 Score: 168.3 bits (425), Expect = 6.1e-39 Identity = 81/90 (90.00%), Postives = 85/90 (94.44%), Query Frame = 1
BLAST of Cucsa.182040 vs. NCBI nr
Match: gi|449435996|ref|XP_004135780.1| (PREDICTED: nuclear transcription factor Y subunit B-4-like [Cucumis sativus]) HSP 1 Score: 160.2 bits (404), Expect = 1.7e-36 Identity = 77/85 (90.59%), Postives = 83/85 (97.65%), Query Frame = 1
BLAST of Cucsa.182040 vs. NCBI nr
Match: gi|659100537|ref|XP_008451142.1| (PREDICTED: nuclear transcription factor Y subunit B-4 [Cucumis melo]) HSP 1 Score: 142.9 bits (359), Expect = 2.8e-31 Identity = 70/84 (83.33%), Postives = 75/84 (89.29%), Query Frame = 1
BLAST of Cucsa.182040 vs. NCBI nr
Match: gi|1012236535|ref|XP_015939806.1| (PREDICTED: nuclear transcription factor Y subunit B-4-like [Arachis duranensis]) HSP 1 Score: 120.9 bits (302), Expect = 1.1e-24 Identity = 57/86 (66.28%), Postives = 67/86 (77.91%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|