Cucsa.178720 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.AGTATGGCGTACTTCTCCTGTTTGAATCGGGGTTTGATACCAAACTTCTCCTCAGGAGGATAGATGGGGCGATTAAGGTGAGATCCAATGTAGATCCAACTTTCTATTCACTCGTGGGATCCGAGCGGTCTAGGGGGGACCACCTTGGCTCCTTTCTTCTCGAGAATCCATACATCCCTTATTAG AGTATGGCGTACTTCTCCTGTTTGAATCGGGGTTTGATACCAAACTTCTCCTCAGGAGGATAGATGGGGCGATTAAGGTGAGATCCAATGTAGATCCAACTTTCTATTCACTCGTGGGATCCGAGCGGTCTAGGGGGGACCACCTTGGCTCCTTTCTTCTCGAGAATCCATACATCCCTTATTAG AGTATGGCGTACTTCTCCTGTTTGAATCGGGGTTTGATACCAAACTTCTCCTCAGGAGGATAGATGGGGCGATTAAGGTGAGATCCAATGTAGATCCAACTTTCTATTCACTCGTGGGATCCGAGCGGTCTAGGGGGGACCACCTTGGCTCCTTTCTTCTCGAGAATCCATACATCCCTTATTAG YGVLLLFESGFDTKLLLRRIDGAIKVRSNVDPTFYSLVGSERSRGDHLGSFLLENPYIPY*
BLAST of Cucsa.178720 vs. Swiss-Prot
Match: YCF68_EUCGG (Uncharacterized protein ycf68 OS=Eucalyptus globulus subsp. globulus GN=ycf68-1 PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.3e-16 Identity = 43/52 (82.69%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Cucsa.178720 vs. Swiss-Prot
Match: YCF68_PINKO (Uncharacterized protein ycf68 OS=Pinus koraiensis GN=ycf68 PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 8.6e-13 Identity = 39/58 (67.24%), Postives = 42/58 (72.41%), Query Frame = 1
BLAST of Cucsa.178720 vs. Swiss-Prot
Match: YCF68_PINTH (Uncharacterized protein ycf68 OS=Pinus thunbergii GN=ycf68 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 4.3e-12 Identity = 39/58 (67.24%), Postives = 42/58 (72.41%), Query Frame = 1
BLAST of Cucsa.178720 vs. Swiss-Prot
Match: YCF68_MAIZE (Uncharacterized protein ycf68 OS=Zea mays GN=ycf68 PE=3 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 1.6e-06 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 1
BLAST of Cucsa.178720 vs. Swiss-Prot
Match: YCF68_SACHY (Uncharacterized protein ycf68 OS=Saccharum hybrid GN=ycf68-1 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.6e-06 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 1
BLAST of Cucsa.178720 vs. TrEMBL
Match: A0A022Q388_ERYGU (Uncharacterized protein (Fragment) OS=Erythranthe guttata GN=MIMGU_mgv1a019258mg PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 5.3e-17 Identity = 47/60 (78.33%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of Cucsa.178720 vs. TrEMBL
Match: A0A109R0E0_9ROSI (Ycf68 OS=Boswellia sacra GN=ycf68 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.5e-16 Identity = 44/51 (86.27%), Postives = 47/51 (92.16%), Query Frame = 1
BLAST of Cucsa.178720 vs. TrEMBL
Match: A0A088DAC6_CITAU (Hypothetical chloroplast RF68 OS=Citrus aurantiifolia GN=ycf68 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.7e-15 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 1
BLAST of Cucsa.178720 vs. TrEMBL
Match: T1QNJ8_EUCSL (Uncharacterized protein OS=Eucalyptus salmonophloia GN=ORF113 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.4e-14 Identity = 43/52 (82.69%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Cucsa.178720 vs. TrEMBL
Match: T1QQF2_9MYRT (Uncharacterized protein OS=Stockwellia quadrifida GN=ORF113 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.4e-14 Identity = 43/52 (82.69%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Cucsa.178720 vs. NCBI nr
Match: gi|604301234|gb|EYU20945.1| (hypothetical protein MIMGU_mgv1a019258mg, partial [Erythranthe guttata]) HSP 1 Score: 94.4 bits (233), Expect = 7.6e-17 Identity = 47/60 (78.33%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of Cucsa.178720 vs. NCBI nr
Match: gi|1002164102|ref|YP_009234263.1| (ycf68 (chloroplast) [Boswellia sacra]) HSP 1 Score: 91.3 bits (225), Expect = 6.4e-16 Identity = 44/51 (86.27%), Postives = 47/51 (92.16%), Query Frame = 1
BLAST of Cucsa.178720 vs. NCBI nr
Match: gi|697964811|ref|YP_009059396.1| (hypothetical chloroplast RF68 (chloroplast) [Citrus aurantiifolia]) HSP 1 Score: 89.4 bits (220), Expect = 2.4e-15 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 1
BLAST of Cucsa.178720 vs. NCBI nr
Match: gi|545718613|ref|YP_008577454.1| (hypothetical protein EGUI_CP_p070 (chloroplast) [Eucalyptus guilfoylei]) HSP 1 Score: 86.3 bits (212), Expect = 2.1e-14 Identity = 43/52 (82.69%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Cucsa.178720 vs. NCBI nr
Match: gi|108802688|ref|YP_636345.1| (hypothetical protein EuglglCp070 (chloroplast) [Eucalyptus globulus subsp. globulus]) HSP 1 Score: 86.3 bits (212), Expect = 2.1e-14 Identity = 43/52 (82.69%), Postives = 46/52 (88.46%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|