Cucsa.162910 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCTTAAGCTTACTCCTCAGCAACTGCTAGTCTATAATGGCAGCGACCGATCGAAGCCTCTGTATGTGGCTTTGAAAGGCTGCATCTACGATGTCACAAAATCCGTTTTATTGTACGGCCTTGGTGGGTCTTACAACATGTTCGCTGGCAAGGATGCGAGCAGAGCTTTGGCCAAGATGAGCAAGAACGTATCGGACATCACCTCGTCGCTCGTGGGCCTTTCTAAGAAAGAAATCAGTGTTCTCAACGATTGGGAGAAGAAATTTCAAGCTAAATACCCTATTGTTGGCCGAGTTGTTTGA ATGGAGCTTAAGCTTACTCCTCAGCAACTGCTAGTCTATAATGGCAGCGACCGATCGAAGCCTCTGTATGTGGCTTTGAAAGGCTGCATCTACGATGTCACAAAATCCGTTTTATTGTACGGCCTTGGTGGGTCTTACAACATGTTCGCTGGCAAGGATGCGAGCAGAGCTTTGGCCAAGATGAGCAAGAACGTATCGGACATCACCTCGTCGCTCGTGGGCCTTTCTAAGAAAGAAATCAGTGTTCTCAACGATTGGGAGAAGAAATTTCAAGCTAAATACCCTATTGTTGGCCGAGTTGTTTGA ATGGAGCTTAAGCTTACTCCTCAGCAACTGCTAGTCTATAATGGCAGCGACCGATCGAAGCCTCTGTATGTGGCTTTGAAAGGCTGCATCTACGATGTCACAAAATCCGTTTTATTGTACGGCCTTGGTGGGTCTTACAACATGTTCGCTGGCAAGGATGCGAGCAGAGCTTTGGCCAAGATGAGCAAGAACGTATCGGACATCACCTCGTCGCTCGTGGGCCTTTCTAAGAAAGAAATCAGTGTTCTCAACGATTGGGAGAAGAAATTTCAAGCTAAATACCCTATTGTTGGCCGAGTTGTTTGA MELKLTPQQLLVYNGSDRSKPLYVALKGCIYDVTKSVLLYGLGGSYNMFAGKDASRALAKMSKNVSDITSSLVGLSKKEISVLNDWEKKFQAKYPIVGRVV*
BLAST of Cucsa.162910 vs. Swiss-Prot
Match: SBP3_ARATH (Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.4e-31 Identity = 63/99 (63.64%), Postives = 79/99 (79.80%), Query Frame = 1
BLAST of Cucsa.162910 vs. Swiss-Prot
Match: MSBP2_ARATH (Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.4e-22 Identity = 51/97 (52.58%), Postives = 68/97 (70.10%), Query Frame = 1
BLAST of Cucsa.162910 vs. Swiss-Prot
Match: MSBP1_ARATH (Membrane steroid-binding protein 1 OS=Arabidopsis thaliana GN=MSBP1 PE=1 SV=2) HSP 1 Score: 102.1 bits (253), Expect = 3.8e-21 Identity = 52/97 (53.61%), Postives = 66/97 (68.04%), Query Frame = 1
BLAST of Cucsa.162910 vs. Swiss-Prot
Match: NENF_RAT (Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 3.9e-18 Identity = 43/94 (45.74%), Postives = 65/94 (69.15%), Query Frame = 1
BLAST of Cucsa.162910 vs. Swiss-Prot
Match: NENF_MOUSE (Neudesin OS=Mus musculus GN=Nenf PE=1 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 6.7e-18 Identity = 43/94 (45.74%), Postives = 63/94 (67.02%), Query Frame = 1
BLAST of Cucsa.162910 vs. TrEMBL
Match: A0A0A0LMK3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G382760 PE=3 SV=1) HSP 1 Score: 200.3 bits (508), Expect = 1.1e-48 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of Cucsa.162910 vs. TrEMBL
Match: A0A0A0LQG3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G382750 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 1.1e-32 Identity = 74/99 (74.75%), Postives = 82/99 (82.83%), Query Frame = 1
BLAST of Cucsa.162910 vs. TrEMBL
Match: M5XM79_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013839mg PE=3 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.7e-31 Identity = 70/99 (70.71%), Postives = 82/99 (82.83%), Query Frame = 1
BLAST of Cucsa.162910 vs. TrEMBL
Match: A0A0S3RBL7_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.02G070400 PE=3 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 2.2e-31 Identity = 70/99 (70.71%), Postives = 80/99 (80.81%), Query Frame = 1
BLAST of Cucsa.162910 vs. TrEMBL
Match: A0A0L9UHB3_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan04g227400 PE=3 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 2.2e-31 Identity = 70/99 (70.71%), Postives = 80/99 (80.81%), Query Frame = 1
BLAST of Cucsa.162910 vs. TAIR10
Match: AT2G24940.1 (AT2G24940.1 membrane-associated progesterone binding protein 2) HSP 1 Score: 136.0 bits (341), Expect = 1.3e-32 Identity = 63/99 (63.64%), Postives = 79/99 (79.80%), Query Frame = 1
BLAST of Cucsa.162910 vs. TAIR10
Match: AT3G48890.1 (AT3G48890.1 membrane-associated progesterone binding protein 3) HSP 1 Score: 105.5 bits (262), Expect = 1.9e-23 Identity = 51/97 (52.58%), Postives = 68/97 (70.10%), Query Frame = 1
BLAST of Cucsa.162910 vs. TAIR10
Match: AT5G52240.1 (AT5G52240.1 membrane steroid binding protein 1) HSP 1 Score: 102.1 bits (253), Expect = 2.1e-22 Identity = 52/97 (53.61%), Postives = 66/97 (68.04%), Query Frame = 1
BLAST of Cucsa.162910 vs. TAIR10
Match: AT4G14965.1 (AT4G14965.1 membrane-associated progesterone binding protein 4) HSP 1 Score: 81.3 bits (199), Expect = 3.9e-16 Identity = 38/94 (40.43%), Postives = 56/94 (59.57%), Query Frame = 1
BLAST of Cucsa.162910 vs. NCBI nr
Match: gi|449441858|ref|XP_004138699.1| (PREDICTED: probable steroid-binding protein 3 [Cucumis sativus]) HSP 1 Score: 200.3 bits (508), Expect = 1.6e-48 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of Cucsa.162910 vs. NCBI nr
Match: gi|659089000|ref|XP_008445275.1| (PREDICTED: probable steroid-binding protein 3 [Cucumis melo]) HSP 1 Score: 184.9 bits (468), Expect = 7.1e-44 Identity = 93/101 (92.08%), Postives = 97/101 (96.04%), Query Frame = 1
BLAST of Cucsa.162910 vs. NCBI nr
Match: gi|659088998|ref|XP_008445274.1| (PREDICTED: probable steroid-binding protein 3 [Cucumis melo]) HSP 1 Score: 151.0 bits (380), Expect = 1.1e-33 Identity = 75/99 (75.76%), Postives = 83/99 (83.84%), Query Frame = 1
BLAST of Cucsa.162910 vs. NCBI nr
Match: gi|449441856|ref|XP_004138698.1| (PREDICTED: probable steroid-binding protein 3 [Cucumis sativus]) HSP 1 Score: 147.1 bits (370), Expect = 1.6e-32 Identity = 74/99 (74.75%), Postives = 82/99 (82.83%), Query Frame = 1
BLAST of Cucsa.162910 vs. NCBI nr
Match: gi|596288910|ref|XP_007226013.1| (hypothetical protein PRUPE_ppa013839mg [Prunus persica]) HSP 1 Score: 143.3 bits (360), Expect = 2.4e-31 Identity = 70/99 (70.71%), Postives = 82/99 (82.83%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |