ClCG06G009210 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGTCACTTTTACATTTTCATTATTTTGCAATCCCTTGGGTATGCTACCTTATAGCTTCATAGTTTCAAGTCATTTTCTTATTACTTTAGGTCTCTAATTTTCTTTTTTTATTGATATTACTATGGTGGGATTTCAAAGAAATAGGCTTCATTTTTAAAGTTTCTCATTACCCTCAGGAGTCCCACTGCCATTAGCACCTTTTTTAGTACTCCTTGGGCTAATCCCTTATTATTTTCGTGCATTTAGCTCAGGAATACGTTTAGTTACCAATGTGATGGTCGATCATAGTTTAGTAAAGATTTTAAGTGGGTTCGCTTGGACTATGCTATGTATGAATAATCTTTTCTATTTCATACGAGATCCTAGTTCTTTATTGTTCTTGCATTAACTGGTTTGGAATTAGGTGTAGCTATATCACAAGCTCATGTTTCTACAATCTCAAGATGTATTTACTTGAATGATGTTATTACCAATTAG ATGTCTGTCACTTTTACATTTTCATTATTTTGCAATCCCTTGGGTATGCTACCTTATAGCTTCATAGTTTCAAGTCATTTTCTTATTACTTTAGGAGTCCCACTGCCATTAGCACCTTTTTTAGTACTCCTTGGGCTAATCCCTTATTATTTTCGTGCATTTAGCTCAGGAATACGTTTAGTTACCAATGTGATGGTCGATCATAGTTTAGTAAAGATTTTAAGTGGGTTCGCTTGGACTATGCTATGTATGAATAATCTTTTCTATTTCATACGAGATCCTAGTGTAGCTATATCACAAGCTCATGTTTCTACAATCTCAAGATGTATTTACTTGAATGATGTTATTACCAATTAG ATGTCTGTCACTTTTACATTTTCATTATTTTGCAATCCCTTGGGTATGCTACCTTATAGCTTCATAGTTTCAAGTCATTTTCTTATTACTTTAGGAGTCCCACTGCCATTAGCACCTTTTTTAGTACTCCTTGGGCTAATCCCTTATTATTTTCGTGCATTTAGCTCAGGAATACGTTTAGTTACCAATGTGATGGTCGATCATAGTTTAGTAAAGATTTTAAGTGGGTTCGCTTGGACTATGCTATGTATGAATAATCTTTTCTATTTCATACGAGATCCTAGTGTAGCTATATCACAAGCTCATGTTTCTACAATCTCAAGATGTATTTACTTGAATGATGTTATTACCAATTAG MSVTFTFSLFCNPLGMLPYSFIVSSHFLITLGVPLPLAPFLVLLGLIPYYFRAFSSGIRLVTNVMVDHSLVKILSGFAWTMLCMNNLFYFIRDPSVAISQAHVSTISRCIYLNDVITN
BLAST of ClCG06G009210 vs. Swiss-Prot
Match: ATP6_TOBAC (ATP synthase subunit a OS=Nicotiana tabacum GN=ATP6 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.1e-39 Identity = 94/159 (59.12%), Postives = 97/159 (61.01%), Query Frame = 1
BLAST of ClCG06G009210 vs. Swiss-Prot
Match: ATP6_VICFA (ATP synthase subunit a OS=Vicia faba GN=ATP6 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.8e-36 Identity = 90/155 (58.06%), Postives = 92/155 (59.35%), Query Frame = 1
BLAST of ClCG06G009210 vs. Swiss-Prot
Match: ATP6_WHEAT (ATP synthase subunit a OS=Triticum aestivum GN=ATP6 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.8e-36 Identity = 90/157 (57.32%), Postives = 95/157 (60.51%), Query Frame = 1
BLAST of ClCG06G009210 vs. Swiss-Prot
Match: ATP6_TRITI (ATP synthase subunit a OS=Triticum timopheevii GN=ATP6 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.8e-36 Identity = 90/157 (57.32%), Postives = 95/157 (60.51%), Query Frame = 1
BLAST of ClCG06G009210 vs. Swiss-Prot
Match: ATP6_MAIZE (ATP synthase subunit a OS=Zea mays GN=ATP6 PE=3 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.8e-35 Identity = 88/157 (56.05%), Postives = 95/157 (60.51%), Query Frame = 1
BLAST of ClCG06G009210 vs. TrEMBL
Match: B2VPV2_9ROSI (ATP synthase subunit a (Fragment) OS=Humiria wurdackii GN=atp6 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 2.1e-38 Identity = 95/159 (59.75%), Postives = 101/159 (63.52%), Query Frame = 1
BLAST of ClCG06G009210 vs. TrEMBL
Match: Q9TGX4_SOLTU (ATP synthase subunit a OS=Solanum tuberosum GN=atp6 PE=3 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 4.7e-38 Identity = 95/159 (59.75%), Postives = 100/159 (62.89%), Query Frame = 1
BLAST of ClCG06G009210 vs. TrEMBL
Match: A0A0C5APW9_HYONI (ATP synthase subunit a OS=Hyoscyamus niger GN=atp6 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.3e-37 Identity = 94/159 (59.12%), Postives = 99/159 (62.26%), Query Frame = 1
BLAST of ClCG06G009210 vs. TrEMBL
Match: A0A0C5B353_9SOLA (ATP synthase subunit a OS=Nicotiana tabacum/Hyoscyamus niger cybrid GN=atp6 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.3e-37 Identity = 94/159 (59.12%), Postives = 99/159 (62.26%), Query Frame = 1
BLAST of ClCG06G009210 vs. TrEMBL
Match: Q36730_PETPA (ATP synthase subunit a OS=Petunia parodii GN=atp6 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.3e-37 Identity = 94/159 (59.12%), Postives = 99/159 (62.26%), Query Frame = 1
BLAST of ClCG06G009210 vs. TAIR10
Match: AT2G07741.1 (AT2G07741.1 ATPase, F0 complex, subunit A protein) HSP 1 Score: 142.5 bits (358), Expect = 1.7e-34 Identity = 85/157 (54.14%), Postives = 90/157 (57.32%), Query Frame = 1
BLAST of ClCG06G009210 vs. TAIR10
Match: ATMG01170.1 (ATMG01170.1 ATPase, F0 complex, subunit A protein) HSP 1 Score: 142.5 bits (358), Expect = 1.7e-34 Identity = 85/157 (54.14%), Postives = 90/157 (57.32%), Query Frame = 1
BLAST of ClCG06G009210 vs. TAIR10
Match: ATMG00410.1 (ATMG00410.1 ATPase subunit 6-1) HSP 1 Score: 142.5 bits (358), Expect = 1.7e-34 Identity = 85/157 (54.14%), Postives = 90/157 (57.32%), Query Frame = 1
BLAST of ClCG06G009210 vs. NCBI nr
Match: gi|187236983|gb|ACD02170.1| (ATPase subunit 6, partial (mitochondrion) [Humiria wurdackii]) HSP 1 Score: 166.4 bits (420), Expect = 3.0e-38 Identity = 95/159 (59.75%), Postives = 101/159 (63.52%), Query Frame = 1
BLAST of ClCG06G009210 vs. NCBI nr
Match: gi|4416214|gb|AAD20262.1| (ATP synthase subunit 6 [Solanum tuberosum]) HSP 1 Score: 165.2 bits (417), Expect = 6.7e-38 Identity = 95/159 (59.75%), Postives = 100/159 (62.89%), Query Frame = 1
BLAST of ClCG06G009210 vs. NCBI nr
Match: gi|57013888|ref|YP_173362.1| (ATP synthase F0 subunit 6 [Nicotiana tabacum]) HSP 1 Score: 162.9 bits (411), Expect = 3.3e-37 Identity = 94/159 (59.12%), Postives = 99/159 (62.26%), Query Frame = 1
BLAST of ClCG06G009210 vs. NCBI nr
Match: gi|71724856|gb|AAZ38889.1| (ATP synthase subunit 6-2 [Capsicum annuum]) HSP 1 Score: 162.9 bits (411), Expect = 3.3e-37 Identity = 94/159 (59.12%), Postives = 99/159 (62.26%), Query Frame = 1
BLAST of ClCG06G009210 vs. NCBI nr
Match: gi|814071728|ref|YP_009121970.1| (ATPase subunit 6 (mitochondrion) [Hyoscyamus niger]) HSP 1 Score: 162.9 bits (411), Expect = 3.3e-37 Identity = 94/159 (59.12%), Postives = 99/159 (62.26%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|