Csa7G452160 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTTGCTTAGACTGAAAAATGTTGCACATTTCTCTCAGGTTACAATTCTTATGAGAGTTCATCACAGAAATTTAACGAACCTTGTAGGGTATATGAATGATGAGGGTCACCTTGGCCTCATTTATGAGTACATGGCCAAAGGAAATTTGGCCGAGCATCTTTCTGGTAATCTTCTAGCTCTAGCTGCAACTTACAAGCTTATAGAACATACTTCACTACCCAATTCCTGA ATGTCTTTGCTTAGACTGAAAAATGTTGCACATTTCTCTCAGGTTACAATTCTTATGAGAGTTCATCACAGAAATTTAACGAACCTTGTAGGGTATATGAATGATGAGGGTCACCTTGGCCTCATTTATGAGTACATGGCCAAAGGAAATTTGGCCGAGCATCTTTCTGGTAATCTTCTAGCTCTAGCTGCAACTTACAAGCTTATAGAACATACTTCACTACCCAATTCCTGA ATGTCTTTGCTTAGACTGAAAAATGTTGCACATTTCTCTCAGGTTACAATTCTTATGAGAGTTCATCACAGAAATTTAACGAACCTTGTAGGGTATATGAATGATGAGGGTCACCTTGGCCTCATTTATGAGTACATGGCCAAAGGAAATTTGGCCGAGCATCTTTCTGGTAATCTTCTAGCTCTAGCTGCAACTTACAAGCTTATAGAACATACTTCACTACCCAATTCCTGA MSLLRLKNVAHFSQVTILMRVHHRNLTNLVGYMNDEGHLGLIYEYMAKGNLAEHLSGNLLALAATYKLIEHTSLPNS*
BLAST of Csa7G452160 vs. Swiss-Prot
Match: Y5169_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana GN=At5g16900 PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.5e-09 Identity = 27/45 (60.00%), Postives = 34/45 (75.56%), Query Frame = 1
BLAST of Csa7G452160 vs. Swiss-Prot
Match: Y1570_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g05700 OS=Arabidopsis thaliana GN=At1g05700 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.0e-09 Identity = 26/45 (57.78%), Postives = 35/45 (77.78%), Query Frame = 1
BLAST of Csa7G452160 vs. Swiss-Prot
Match: Y5573_ARATH (Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2) HSP 1 Score: 62.8 bits (151), Expect = 2.0e-09 Identity = 27/46 (58.70%), Postives = 35/46 (76.09%), Query Frame = 1
BLAST of Csa7G452160 vs. Swiss-Prot
Match: MEE39_ARATH (Probable LRR receptor-like serine/threonine-protein kinase MEE39 OS=Arabidopsis thaliana GN=MEE39 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.5e-09 Identity = 26/45 (57.78%), Postives = 34/45 (75.56%), Query Frame = 1
BLAST of Csa7G452160 vs. Swiss-Prot
Match: SIRK_ARATH (Senescence-induced receptor-like serine/threonine-protein kinase OS=Arabidopsis thaliana GN=SIRK PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 4.3e-09 Identity = 27/45 (60.00%), Postives = 34/45 (75.56%), Query Frame = 1
BLAST of Csa7G452160 vs. TrEMBL
Match: A0A0A0KCS2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452160 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 1.4e-35 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 1
BLAST of Csa7G452160 vs. TrEMBL
Match: A0A0A0K9P9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452140 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 9.4e-19 Identity = 48/56 (85.71%), Postives = 51/56 (91.07%), Query Frame = 1
BLAST of Csa7G452160 vs. TrEMBL
Match: A0A0A0K7Y5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452180 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.7e-16 Identity = 42/44 (95.45%), Postives = 44/44 (100.00%), Query Frame = 1
BLAST of Csa7G452160 vs. TrEMBL
Match: A0A0A0K792_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452200 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.7e-12 Identity = 35/44 (79.55%), Postives = 42/44 (95.45%), Query Frame = 1
BLAST of Csa7G452160 vs. TrEMBL
Match: A0A0A0KB17_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452220 PE=3 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 5.5e-11 Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = 1
BLAST of Csa7G452160 vs. TAIR10
Match: AT4G29990.1 (AT4G29990.1 Leucine-rich repeat transmembrane protein kinase protein) HSP 1 Score: 68.6 bits (166), Expect = 2.0e-12 Identity = 28/45 (62.22%), Postives = 36/45 (80.00%), Query Frame = 1
BLAST of Csa7G452160 vs. TAIR10
Match: AT2G29000.1 (AT2G29000.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 67.0 bits (162), Expect = 5.8e-12 Identity = 29/54 (53.70%), Postives = 37/54 (68.52%), Query Frame = 1
BLAST of Csa7G452160 vs. TAIR10
Match: AT2G28970.1 (AT2G28970.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 63.9 bits (154), Expect = 4.9e-11 Identity = 29/48 (60.42%), Postives = 37/48 (77.08%), Query Frame = 1
BLAST of Csa7G452160 vs. TAIR10
Match: AT5G16900.1 (AT5G16900.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 63.2 bits (152), Expect = 8.4e-11 Identity = 27/45 (60.00%), Postives = 34/45 (75.56%), Query Frame = 1
BLAST of Csa7G452160 vs. TAIR10
Match: AT1G05700.1 (AT1G05700.1 Leucine-rich repeat transmembrane protein kinase protein) HSP 1 Score: 62.8 bits (151), Expect = 1.1e-10 Identity = 26/45 (57.78%), Postives = 35/45 (77.78%), Query Frame = 1
BLAST of Csa7G452160 vs. NCBI nr
Match: gi|700190328|gb|KGN45561.1| (hypothetical protein Csa_7G452160 [Cucumis sativus]) HSP 1 Score: 156.4 bits (394), Expect = 2.1e-35 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 1
BLAST of Csa7G452160 vs. NCBI nr
Match: gi|700190326|gb|KGN45559.1| (hypothetical protein Csa_7G452140 [Cucumis sativus]) HSP 1 Score: 100.5 bits (249), Expect = 1.3e-18 Identity = 48/56 (85.71%), Postives = 51/56 (91.07%), Query Frame = 1
BLAST of Csa7G452160 vs. NCBI nr
Match: gi|778730526|ref|XP_011659808.1| (PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g51880 [Cucumis sativus]) HSP 1 Score: 99.0 bits (245), Expect = 3.9e-18 Identity = 46/48 (95.83%), Postives = 48/48 (100.00%), Query Frame = 1
BLAST of Csa7G452160 vs. NCBI nr
Match: gi|659125002|ref|XP_008462458.1| (PREDICTED: putative leucine-rich repeat receptor-like protein kinase At2g19210 [Cucumis melo]) HSP 1 Score: 91.3 bits (225), Expect = 8.2e-16 Identity = 42/44 (95.45%), Postives = 44/44 (100.00%), Query Frame = 1
BLAST of Csa7G452160 vs. NCBI nr
Match: gi|700190330|gb|KGN45563.1| (hypothetical protein Csa_7G452180 [Cucumis sativus]) HSP 1 Score: 91.3 bits (225), Expect = 8.2e-16 Identity = 42/44 (95.45%), Postives = 44/44 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|