Csa7G339680 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGATCTTGGCACCCAACTCCTGACGGTCACCCTACACGGCCAAGTGCAAGCTCCGTCTTCTAAAGCTTGAGCAAGTCAAGAACTATTTTCTCATGGAGGAGGAGTTTGTTACCAATCAAGAGTTGTTGAAGCCATAGGAGGAGAAAAATGAAGAAGATAGATATAAGGTCGACGACCCACGTGGCTCGCCGATGAGTGTTGGAAATTTGGAGGAGCCGATTGATGAGAATCATGCCATTGTGTCTTCATTTGTCGGTCTGAAGTACTATGTTGGGATCTTGTTGTTTGTCGATAAAGACCAACTCGAGCTAGGATGTGCCATTCTCATGCACAACAACGTAGGTTTTGTTATAGTTGTTAATTTGGCAAATGCTTCGTTCTTGTAA ATGAGATCTTGGCACCCAACTCCTGACGGTCACCCTACACGGCCAAGTGCAAGCTCCGAGGAGAAAAATGAAGAAGATAGATATAAGGTCGACGACCCACGTGGCTCGCCGATGAGTGTTGGAAATTTGGAGGAGCCGATTGATGAGAATCATGCCATTGTGTCTTCATTTGTCGGTCTGAAGTACTATGTTGGGATCTTGTTGTTTGTCGATAAAGACCAACTCGAGCTAGGATGTGCCATTCTCATGCACAACAACGTAGGTTTTGTTATAGTTGTTAATTTGGCAAATGCTTCGTTCTTGTAA ATGAGATCTTGGCACCCAACTCCTGACGGTCACCCTACACGGCCAAGTGCAAGCTCCGAGGAGAAAAATGAAGAAGATAGATATAAGGTCGACGACCCACGTGGCTCGCCGATGAGTGTTGGAAATTTGGAGGAGCCGATTGATGAGAATCATGCCATTGTGTCTTCATTTGTCGGTCTGAAGTACTATGTTGGGATCTTGTTGTTTGTCGATAAAGACCAACTCGAGCTAGGATGTGCCATTCTCATGCACAACAACGTAGGTTTTGTTATAGTTGTTAATTTGGCAAATGCTTCGTTCTTGTAA MRSWHPTPDGHPTRPSASSEEKNEEDRYKVDDPRGSPMSVGNLEEPIDENHAIVSSFVGLKYYVGILLFVDKDQLELGCAILMHNNVGFVIVVNLANASFL*
BLAST of Csa7G339680 vs. Swiss-Prot
Match: PRS4A_ARATH (26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana GN=RPT2A PE=1 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 8.2e-24 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of Csa7G339680 vs. Swiss-Prot
Match: PRS4B_ARATH (26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=1 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 8.2e-24 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of Csa7G339680 vs. Swiss-Prot
Match: PRS4_ORYSJ (26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2) HSP 1 Score: 107.1 bits (266), Expect = 1.2e-22 Identity = 54/73 (73.97%), Postives = 60/73 (82.19%), Query Frame = 1
BLAST of Csa7G339680 vs. Swiss-Prot
Match: PRS4_DROME (26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Rpt2 PE=1 SV=2) HSP 1 Score: 100.1 bits (248), Expect = 1.4e-20 Identity = 49/74 (66.22%), Postives = 60/74 (81.08%), Query Frame = 1
BLAST of Csa7G339680 vs. Swiss-Prot
Match: PRS4_RAT (26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 7.9e-19 Identity = 48/74 (64.86%), Postives = 57/74 (77.03%), Query Frame = 1
BLAST of Csa7G339680 vs. TrEMBL
Match: A0A0A0K9W2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G339680 PE=4 SV=1) HSP 1 Score: 210.3 bits (534), Expect = 1.1e-51 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of Csa7G339680 vs. TrEMBL
Match: A0A067L9D3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_23036 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.2e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of Csa7G339680 vs. TrEMBL
Match: A0A0A0LH67_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G049870 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.2e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of Csa7G339680 vs. TrEMBL
Match: B9SJQ0_RICCO (26S protease regulatory subunit, putative OS=Ricinus communis GN=RCOM_1629040 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.2e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of Csa7G339680 vs. TrEMBL
Match: W1PHT9_AMBTC (Uncharacterized protein OS=Amborella trichopoda GN=AMTR_s00019p00202640 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.8e-23 Identity = 59/72 (81.94%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of Csa7G339680 vs. TAIR10
Match: AT2G20140.1 (AT2G20140.1 AAA-type ATPase family protein) HSP 1 Score: 110.9 bits (276), Expect = 4.6e-25 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of Csa7G339680 vs. TAIR10
Match: AT4G29040.1 (AT4G29040.1 regulatory particle AAA-ATPase 2A) HSP 1 Score: 110.9 bits (276), Expect = 4.6e-25 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of Csa7G339680 vs. NCBI nr
Match: gi|700189363|gb|KGN44596.1| (hypothetical protein Csa_7G339680 [Cucumis sativus]) HSP 1 Score: 210.3 bits (534), Expect = 1.6e-51 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of Csa7G339680 vs. NCBI nr
Match: gi|643737787|gb|KDP43828.1| (hypothetical protein JCGZ_23036 [Jatropha curcas]) HSP 1 Score: 116.3 bits (290), Expect = 3.1e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of Csa7G339680 vs. NCBI nr
Match: gi|449462685|ref|XP_004149071.1| (PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Cucumis sativus]) HSP 1 Score: 116.3 bits (290), Expect = 3.1e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of Csa7G339680 vs. NCBI nr
Match: gi|255570523|ref|XP_002526219.1| (PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Ricinus communis]) HSP 1 Score: 116.3 bits (290), Expect = 3.1e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of Csa7G339680 vs. NCBI nr
Match: gi|802555210|ref|XP_012065309.1| (PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like isoform X1 [Jatropha curcas]) HSP 1 Score: 116.3 bits (290), Expect = 3.1e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |