Csa1G123480 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTATATATATACGTATAACATATATGCTGCATGTAAAAAAGAAGGTGTATTTGTGGTTATACAGATGAAATGGGTGGATGGAGGTGGATACATGGAGATGAATGGAACTCAATATAAACTAAAACAGTGTCATTGGCACTCACCTTCTGAGCACACCATTGATGGCAAGACTTTCGATCTTGAAGCTCACTTAGTTCATGAAAGCTCAAATGGAATGATTTCTGTCATTGGAATCTTGTATCAAATTGGAGAACCCGATTACTTCTTATCAACGGTCAGTTGTTTAATCCATAATTGA ATGAATTATATATATACGTATAACATATATGCTGCATGTAAAAAAGAAGGTGTATTTGTGGTTATACAGATGAAATGGGTGGATGGAGGTGGATACATGGAGATGAATGGAACTCAATATAAACTAAAACAGTGTCATTGGCACTCACCTTCTGAGCACACCATTGATGGCAAGACTTTCGATCTTGAAGCTCACTTAGTTCATGAAAGCTCAAATGGAATGATTTCTGTCATTGGAATCTTGTATCAAATTGGAGAACCCGATTACTTCTTATCAACGGTCAGTTGTTTAATCCATAATTGA ATGAATTATATATATACGTATAACATATATGCTGCATGTAAAAAAGAAGGTGTATTTGTGGTTATACAGATGAAATGGGTGGATGGAGGTGGATACATGGAGATGAATGGAACTCAATATAAACTAAAACAGTGTCATTGGCACTCACCTTCTGAGCACACCATTGATGGCAAGACTTTCGATCTTGAAGCTCACTTAGTTCATGAAAGCTCAAATGGAATGATTTCTGTCATTGGAATCTTGTATCAAATTGGAGAACCCGATTACTTCTTATCAACGGTCAGTTGTTTAATCCATAATTGA MNYIYTYNIYAACKKEGVFVVIQMKWVDGGGYMEMNGTQYKLKQCHWHSPSEHTIDGKTFDLEAHLVHESSNGMISVIGILYQIGEPDYFLSTVSCLIHN*
BLAST of Csa1G123480 vs. Swiss-Prot
Match: NEC3_NICLS (Bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3 OS=Nicotiana langsdorffii x Nicotiana sanderae GN=NEC3 PE=1 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 4.2e-20 Identity = 45/69 (65.22%), Postives = 56/69 (81.16%), Query Frame = 1
BLAST of Csa1G123480 vs. Swiss-Prot
Match: ATCA6_ARATH (Alpha carbonic anhydrase 6 OS=Arabidopsis thaliana GN=ACA6 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.6e-19 Identity = 38/73 (52.05%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of Csa1G123480 vs. Swiss-Prot
Match: ATCA5_ARATH (Alpha carbonic anhydrase 5 OS=Arabidopsis thaliana GN=ACA5 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 6.6e-18 Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 1
BLAST of Csa1G123480 vs. Swiss-Prot
Match: ATCA2_ARATH (Alpha carbonic anhydrase 2 OS=Arabidopsis thaliana GN=ACA2 PE=2 SV=2) HSP 1 Score: 90.1 bits (222), Expect = 1.5e-17 Identity = 37/64 (57.81%), Postives = 49/64 (76.56%), Query Frame = 1
BLAST of Csa1G123480 vs. Swiss-Prot
Match: ATCA4_ARATH (Alpha carbonic anhydrase 4 OS=Arabidopsis thaliana GN=ACA4 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.3e-17 Identity = 36/71 (50.70%), Postives = 48/71 (67.61%), Query Frame = 1
BLAST of Csa1G123480 vs. TrEMBL
Match: A0A0A0LSQ8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G123480 PE=4 SV=1) HSP 1 Score: 216.9 bits (551), Expect = 1.2e-53 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
BLAST of Csa1G123480 vs. TrEMBL
Match: A0A0A0LXW9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G120470 PE=4 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 5.6e-24 Identity = 52/73 (71.23%), Postives = 61/73 (83.56%), Query Frame = 1
BLAST of Csa1G123480 vs. TrEMBL
Match: A0A0L9UN33_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan05g177300 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.7e-23 Identity = 50/79 (63.29%), Postives = 63/79 (79.75%), Query Frame = 1
BLAST of Csa1G123480 vs. TrEMBL
Match: A0A0S3SGM2_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.07G063900 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.7e-23 Identity = 50/79 (63.29%), Postives = 63/79 (79.75%), Query Frame = 1
BLAST of Csa1G123480 vs. TrEMBL
Match: U5GK55_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0004s22280g PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.8e-23 Identity = 49/74 (66.22%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Csa1G123480 vs. TAIR10
Match: AT4G21000.1 (AT4G21000.1 alpha carbonic anhydrase 6) HSP 1 Score: 96.7 bits (239), Expect = 8.9e-21 Identity = 38/73 (52.05%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of Csa1G123480 vs. TAIR10
Match: AT1G08065.1 (AT1G08065.1 alpha carbonic anhydrase 5) HSP 1 Score: 91.3 bits (225), Expect = 3.7e-19 Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 1
BLAST of Csa1G123480 vs. TAIR10
Match: AT2G28210.1 (AT2G28210.1 alpha carbonic anhydrase 2) HSP 1 Score: 90.1 bits (222), Expect = 8.3e-19 Identity = 37/64 (57.81%), Postives = 49/64 (76.56%), Query Frame = 1
BLAST of Csa1G123480 vs. TAIR10
Match: AT4G20990.1 (AT4G20990.1 alpha carbonic anhydrase 4) HSP 1 Score: 88.6 bits (218), Expect = 2.4e-18 Identity = 36/71 (50.70%), Postives = 48/71 (67.61%), Query Frame = 1
BLAST of Csa1G123480 vs. TAIR10
Match: AT1G08080.1 (AT1G08080.1 alpha carbonic anhydrase 7) HSP 1 Score: 87.4 bits (215), Expect = 5.4e-18 Identity = 36/73 (49.32%), Postives = 53/73 (72.60%), Query Frame = 1
BLAST of Csa1G123480 vs. NCBI nr
Match: gi|700209737|gb|KGN64833.1| (hypothetical protein Csa_1G123480 [Cucumis sativus]) HSP 1 Score: 216.9 bits (551), Expect = 1.7e-53 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
BLAST of Csa1G123480 vs. NCBI nr
Match: gi|449443578|ref|XP_004139554.1| (PREDICTED: alpha carbonic anhydrase 7-like [Cucumis sativus]) HSP 1 Score: 156.0 bits (393), Expect = 3.5e-35 Identity = 70/73 (95.89%), Postives = 72/73 (98.63%), Query Frame = 1
BLAST of Csa1G123480 vs. NCBI nr
Match: gi|659072266|ref|XP_008464591.1| (PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Cucumis melo]) HSP 1 Score: 153.7 bits (387), Expect = 1.7e-34 Identity = 68/73 (93.15%), Postives = 71/73 (97.26%), Query Frame = 1
BLAST of Csa1G123480 vs. NCBI nr
Match: gi|659071954|ref|XP_008462774.1| (PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Cucumis melo]) HSP 1 Score: 121.7 bits (304), Expect = 7.3e-25 Identity = 53/73 (72.60%), Postives = 62/73 (84.93%), Query Frame = 1
BLAST of Csa1G123480 vs. NCBI nr
Match: gi|449443349|ref|XP_004139442.1| (PREDICTED: alpha carbonic anhydrase 7 [Cucumis sativus]) HSP 1 Score: 118.2 bits (295), Expect = 8.1e-24 Identity = 52/73 (71.23%), Postives = 61/73 (83.56%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|