MELO3C012580 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACCCCTAATTCAAATTCGATTTTATGGGTGAACCCTACTACCGTTAATTTTGGGACTAGAGTTGTCAGGGAGTCGAATCCGGTGAGGTCGATGACAGGGAAGAGGAAGGAAAGGGAAAGGGAACGAGACCCATTTGCAAATATGGTGTTCGCCATTAAAACTTTGGGAGATAGGTTTGTGAGAATGGAGAGGATGAAGGTGGAAATGGCTAAAGAGATCGAAGCTATGAGAATGGAAATAGAGATTAAATGA ATGACCCCTAATTCAAATTCGATTTTATGGGTGAACCCTACTACCGTTAATTTTGGGACTAGAGTTGTCAGGGAGTCGAATCCGGTGAGGTCGATGACAGGGAAGAGGAAGGAAAGGGAAAGGGAACGAGACCCATTTGCAAATATGGTGTTCGCCATTAAAACTTTGGGAGATAGGTTTGTGAGAATGGAGAGGATGAAGGTGGAAATGGCTAAAGAGATCGAAGCTATGAGAATGGAAATAGAGATTAAATGA ATGACCCCTAATTCAAATTCGATTTTATGGGTGAACCCTACTACCGTTAATTTTGGGACTAGAGTTGTCAGGGAGTCGAATCCGGTGAGGTCGATGACAGGGAAGAGGAAGGAAAGGGAAAGGGAACGAGACCCATTTGCAAATATGGTGTTCGCCATTAAAACTTTGGGAGATAGGTTTGTGAGAATGGAGAGGATGAAGGTGGAAATGGCTAAAGAGATCGAAGCTATGAGAATGGAAATAGAGATTAAATGA MTPNSNSILWVNPTTVNFGTRVVRESNPVRSMTGKRKERERERDPFANMVFAIKTLGDRFVRMERMKVEMAKEIEAMRMEIEIK*
BLAST of MELO3C012580 vs. TrEMBL
Match: A0A0A0L413_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G129620 PE=4 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 4.1e-28 Identity = 66/84 (78.57%), Postives = 72/84 (85.71%), Query Frame = 1
BLAST of MELO3C012580 vs. TrEMBL
Match: M5X9S0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa010478m2g PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 3.2e-12 Identity = 50/85 (58.82%), Postives = 60/85 (70.59%), Query Frame = 1
BLAST of MELO3C012580 vs. TrEMBL
Match: W9R598_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_008033 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.2e-12 Identity = 43/69 (62.32%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of MELO3C012580 vs. TrEMBL
Match: A2Q1W1_MEDTR (MADF; Homeodomain-like OS=Medicago truncatula GN=MTR_7g081190 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 7.1e-12 Identity = 44/74 (59.46%), Postives = 54/74 (72.97%), Query Frame = 1
BLAST of MELO3C012580 vs. TrEMBL
Match: A0A0D2S0Z5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G167100 PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.7e-11 Identity = 38/67 (56.72%), Postives = 48/67 (71.64%), Query Frame = 1
BLAST of MELO3C012580 vs. TAIR10
Match: AT2G44730.1 (AT2G44730.1 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein) HSP 1 Score: 56.6 bits (135), Expect = 8.6e-09 Identity = 31/70 (44.29%), Postives = 39/70 (55.71%), Query Frame = 1
BLAST of MELO3C012580 vs. NCBI nr
Match: gi|449432382|ref|XP_004133978.1| (PREDICTED: trihelix transcription factor ASIL2 isoform X1 [Cucumis sativus]) HSP 1 Score: 131.7 bits (330), Expect = 6.0e-28 Identity = 66/84 (78.57%), Postives = 72/84 (85.71%), Query Frame = 1
BLAST of MELO3C012580 vs. NCBI nr
Match: gi|659075756|ref|XP_008438313.1| (PREDICTED: B-cell lymphoma/leukemia 11B [Cucumis melo]) HSP 1 Score: 131.7 bits (330), Expect = 6.0e-28 Identity = 66/84 (78.57%), Postives = 72/84 (85.71%), Query Frame = 1
BLAST of MELO3C012580 vs. NCBI nr
Match: gi|657949536|ref|XP_008343662.1| (PREDICTED: uncharacterized protein LOC103406460 [Malus domestica]) HSP 1 Score: 80.9 bits (198), Expect = 1.2e-12 Identity = 46/76 (60.53%), Postives = 56/76 (73.68%), Query Frame = 1
BLAST of MELO3C012580 vs. NCBI nr
Match: gi|645253048|ref|XP_008232402.1| (PREDICTED: uncharacterized protein LOC103331547, partial [Prunus mume]) HSP 1 Score: 79.0 bits (193), Expect = 4.6e-12 Identity = 50/85 (58.82%), Postives = 60/85 (70.59%), Query Frame = 1
BLAST of MELO3C012580 vs. NCBI nr
Match: gi|596058739|ref|XP_007221022.1| (hypothetical protein PRUPE_ppa010478m2g [Prunus persica]) HSP 1 Score: 79.0 bits (193), Expect = 4.6e-12 Identity = 50/85 (58.82%), Postives = 60/85 (70.59%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|