MELO3C024740 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACCTAAAGAGCTGAAAGAATTGAAGACACAGTTACAAGAGTTGGTAGACAAGGGTTATATCCGACTGAGTGTATCACCATGGGGTGCACCAGTGCTGTTTGTGAAAAAGAAGGATGGCACCTTGAGATTGTGTATTAATTACAGACAGTTGAACAAGGTGCCTATAAGCAATAAATATTCATTGCCTCGAATAGATGATTTATTCGATCAGCTTAAAGGTACCTCAGTGTTTTCAAAAGTTGATCTACGTTCAGGATATCATCAACTTAAGATAAAGGAAGCAGATGTTCCAAAAACAACATTCAGAACATGA ATGGCACCTAAAGAGCTGAAAGAATTGAAGACACAGTTACAAGAGTTGGTAGACAAGGGTTATATCCGACTGAGTGTATCACCATGGGGTGCACCAGTGCTGTTTGTGAAAAAGAAGGATGGCACCTTGAGATTGTGTATTAATTACAGACAGTTGAACAAGGTGCCTATAAGCAATAAATATTCATTGCCTCGAATAGATGATTTATTCGATCAGCTTAAAGGTACCTCAGTGTTTTCAAAAGTTGATCTACGTTCAGGATATCATCAACTTAAGATAAAGGAAGCAGATGTTCCAAAAACAACATTCAGAACATGA ATGGCACCTAAAGAGCTGAAAGAATTGAAGACACAGTTACAAGAGTTGGTAGACAAGGGTTATATCCGACTGAGTGTATCACCATGGGGTGCACCAGTGCTGTTTGTGAAAAAGAAGGATGGCACCTTGAGATTGTGTATTAATTACAGACAGTTGAACAAGGTGCCTATAAGCAATAAATATTCATTGCCTCGAATAGATGATTTATTCGATCAGCTTAAAGGTACCTCAGTGTTTTCAAAAGTTGATCTACGTTCAGGATATCATCAACTTAAGATAAAGGAAGCAGATGTTCCAAAAACAACATTCAGAACATGA MAPKELKELKTQLQELVDKGYIRLSVSPWGAPVLFVKKKDGTLRLCINYRQLNKVPISNKYSLPRIDDLFDQLKGTSVFSKVDLRSGYHQLKIKEADVPKTTFRT*
BLAST of MELO3C024740 vs. Swiss-Prot
Match: YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3) HSP 1 Score: 95.1 bits (235), Expect = 4.8e-19 Identity = 46/102 (45.10%), Postives = 65/102 (63.73%), Query Frame = 1
BLAST of MELO3C024740 vs. Swiss-Prot
Match: YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2) HSP 1 Score: 95.1 bits (235), Expect = 4.8e-19 Identity = 46/102 (45.10%), Postives = 65/102 (63.73%), Query Frame = 1
BLAST of MELO3C024740 vs. Swiss-Prot
Match: TF23_SCHPO (Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.9e-15 Identity = 37/104 (35.58%), Postives = 66/104 (63.46%), Query Frame = 1
BLAST of MELO3C024740 vs. Swiss-Prot
Match: TF22_SCHPO (Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.9e-15 Identity = 37/104 (35.58%), Postives = 66/104 (63.46%), Query Frame = 1
BLAST of MELO3C024740 vs. Swiss-Prot
Match: TF25_SCHPO (Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.9e-15 Identity = 37/104 (35.58%), Postives = 66/104 (63.46%), Query Frame = 1
BLAST of MELO3C024740 vs. TrEMBL
Match: A0A061FQA2_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_043787 PE=4 SV=1) HSP 1 Score: 183.3 bits (464), Expect = 1.5e-43 Identity = 88/105 (83.81%), Postives = 96/105 (91.43%), Query Frame = 1
BLAST of MELO3C024740 vs. TrEMBL
Match: A0A061DN15_THECC (Retrotransposon protein OS=Theobroma cacao GN=TCM_003208 PE=4 SV=1) HSP 1 Score: 181.8 bits (460), Expect = 4.4e-43 Identity = 86/105 (81.90%), Postives = 96/105 (91.43%), Query Frame = 1
BLAST of MELO3C024740 vs. TrEMBL
Match: A0A061DMP8_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_003206 PE=4 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 7.4e-43 Identity = 86/105 (81.90%), Postives = 95/105 (90.48%), Query Frame = 1
BLAST of MELO3C024740 vs. TrEMBL
Match: A0A061E5E3_THECC (DNA/RNA polymerases superfamily protein OS=Theobroma cacao GN=TCM_009998 PE=4 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 1.3e-42 Identity = 86/105 (81.90%), Postives = 95/105 (90.48%), Query Frame = 1
BLAST of MELO3C024740 vs. TrEMBL
Match: A0A061FC59_THECC (Retrotransposon protein, putative OS=Theobroma cacao GN=TCM_033634 PE=4 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 1.3e-42 Identity = 86/105 (81.90%), Postives = 95/105 (90.48%), Query Frame = 1
BLAST of MELO3C024740 vs. NCBI nr
Match: gi|515538865|ref|WP_016971918.1| (hypothetical protein [Pseudomonas tolaasii]) HSP 1 Score: 184.9 bits (468), Expect = 7.4e-44 Identity = 87/105 (82.86%), Postives = 96/105 (91.43%), Query Frame = 1
BLAST of MELO3C024740 vs. NCBI nr
Match: gi|590566597|ref|XP_007010278.1| (Uncharacterized protein TCM_043787 [Theobroma cacao]) HSP 1 Score: 183.3 bits (464), Expect = 2.1e-43 Identity = 88/105 (83.81%), Postives = 96/105 (91.43%), Query Frame = 1
BLAST of MELO3C024740 vs. NCBI nr
Match: gi|590714511|ref|XP_007049933.1| (Retrotransposon protein [Theobroma cacao]) HSP 1 Score: 181.8 bits (460), Expect = 6.3e-43 Identity = 86/105 (81.90%), Postives = 96/105 (91.43%), Query Frame = 1
BLAST of MELO3C024740 vs. NCBI nr
Match: gi|590714507|ref|XP_007049932.1| (Uncharacterized protein TCM_003206 [Theobroma cacao]) HSP 1 Score: 181.0 bits (458), Expect = 1.1e-42 Identity = 86/105 (81.90%), Postives = 95/105 (90.48%), Query Frame = 1
BLAST of MELO3C024740 vs. NCBI nr
Match: gi|848868789|ref|XP_012835023.1| (PREDICTED: uncharacterized protein LOC105955775 [Erythranthe guttata]) HSP 1 Score: 180.3 bits (456), Expect = 1.8e-42 Identity = 85/105 (80.95%), Postives = 96/105 (91.43%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|