MELO3C035423.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CACTGAAGCAATGTAGCCTGATCTTATTCAAAAAGTTAAAGACGGTGAACTTAATGCAATTGTGACGTACATTTTTTGGGATCGTCACGAGCCACAACGACGAAAATATGATTTCTCTAAACGTTTAGATTTTATTAAATTCTTCCGACTTATCCAAGATGCTGGACTTTATGTTGTCATGAGGATTGGTTCTTATGTGTGTGCTGAGTGGAACTACGGAGACTTTTCAGTGTGGTTGCATAATATGTCAGGAATTCAACTACGAACTAACAATCAAGTCTACAAGAATGAAATGCAAACTTTCACAACAATGATAGTGAATATGTGTAAACAAGTCAATCTCTTTGCTTTACAAGGAGGGCCAATAATATTAGCTTAAGTTGAGAATGAATGTGGAAATGTGATGACATCAGCTTATGAAGATGCAGGAAAAGAATATATCAATTGGTGTGCTAAAATGGATGAATTTCTCAATATTGGTGTTCCATGGATTATGTGCCAACAAAGTAATGTCCCACAACCTATGATTAATATATGCAATGGATTCTACTGTGATAACTTCCCTCCAAAAAATC CACTGAAGCAATGTAGCCTGATCTTATTCAAAAAGTTAAAGACGGTGAACTTAATGCAATTGTGACGTACATTTTTTGGGATCGTCACGAGCCACAACGACGAAAATATGATTTCTCTAAACGTTTAGATTTTATTAAATTCTTCCGACTTATCCAAGATGCTGGACTTTATGTTGTCATGAGGATTGGTTCTTATGTGTGTGCTGAGTGGAACTACGGAGACTTTTCAGTGTGGTTGCATAATATGTCAGGAATTCAACTACGAACTAACAATCAAGTCTACAAGAATGAAATGCAAACTTTCACAACAATGATAGTGAATATGTGTAAACAAGTCAATCTCTTTGCTTTACAAGGAGGGCCAATAATATTAGCTTAAGTTGAGAATGAATGTGGAAATGTGATGACATCAGCTTATGAAGATGCAGGAAAAGAATATATCAATTGGTGTGCTAAAATGGATGAATTTCTCAATATTGGTGTTCCATGGATTATGTGCCAACAAAGTAATGTCCCACAACCTATGATTAATATATGCAATGGATTCTACTGTGATAACTTCCCTCCAAAAAATC ATGAGGATTGGTTCTTATGTGTGTGCTGAGTGGAACTACGGAGACTTTTCAGTGTGGTTGCATAATATGTCAGGAATTCAACTACGAACTAACAATCAAGTCTACAAGAATGAAATGCAAACTTTCACAACAATGATAGTGAATATGTGTAAACAAGTCAATCTCTTTGCTTTACAAGGAGGGCCAATAATATTAGCTTAA MRIGSYVCAEWNYGDFSVWLHNMSGIQLRTNNQVYKNEMQTFTTMIVNMCKQVNLFALQGGPIILA
BLAST of MELO3C035423.2.1 vs. NCBI nr
Match: XP_008437703.1 (PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis melo]) HSP 1 Score: 127.1 bits (318), Expect = 2.2e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. NCBI nr
Match: XP_008437707.1 (PREDICTED: beta-galactosidase 7-like, partial [Cucumis melo]) HSP 1 Score: 127.1 bits (318), Expect = 2.2e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. NCBI nr
Match: XP_008452141.1 (PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis melo]) HSP 1 Score: 127.1 bits (318), Expect = 2.2e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. NCBI nr
Match: KGN49801.1 (hypothetical protein Csa_5G136360 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 2.2e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. NCBI nr
Match: KGN50376.1 (hypothetical protein Csa_5G169120 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 2.2e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TAIR10
Match: AT1G31740.1 (beta-galactosidase 15) HSP 1 Score: 101.7 bits (252), Expect = 1.8e-22 Identity = 46/66 (69.70%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TAIR10
Match: AT5G20710.1 (beta-galactosidase 7) HSP 1 Score: 95.1 bits (235), Expect = 1.7e-20 Identity = 44/66 (66.67%), Postives = 49/66 (74.24%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TAIR10
Match: AT2G28470.1 (beta-galactosidase 8) HSP 1 Score: 94.0 bits (232), Expect = 3.8e-20 Identity = 42/66 (63.64%), Postives = 52/66 (78.79%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TAIR10
Match: AT2G32810.1 (beta galactosidase 9) HSP 1 Score: 85.9 bits (211), Expect = 1.0e-17 Identity = 36/65 (55.38%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TAIR10
Match: AT3G13750.1 (beta galactosidase 1) HSP 1 Score: 85.5 bits (210), Expect = 1.3e-17 Identity = 40/66 (60.61%), Postives = 47/66 (71.21%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. Swiss-Prot
Match: sp|Q9C6W4|BGA15_ARATH (Beta-galactosidase 15 OS=Arabidopsis thaliana OX=3702 GN=BGAL15 PE=2 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 3.3e-21 Identity = 46/66 (69.70%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. Swiss-Prot
Match: sp|P49676|BGAL_BRAOL (Beta-galactosidase OS=Brassica oleracea OX=3712 PE=2 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 8.0e-20 Identity = 45/66 (68.18%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. Swiss-Prot
Match: sp|Q9SCV5|BGAL7_ARATH (Beta-galactosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BGAL7 PE=2 SV=2) HSP 1 Score: 95.1 bits (235), Expect = 3.0e-19 Identity = 44/66 (66.67%), Postives = 49/66 (74.24%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. Swiss-Prot
Match: sp|Q9SCV4|BGAL8_ARATH (Beta-galactosidase 8 OS=Arabidopsis thaliana OX=3702 GN=BGAL8 PE=2 SV=2) HSP 1 Score: 94.0 bits (232), Expect = 6.8e-19 Identity = 42/66 (63.64%), Postives = 52/66 (78.79%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. Swiss-Prot
Match: sp|Q10NX8|BGAL6_ORYSJ (Beta-galactosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0255100 PE=1 SV=2) HSP 1 Score: 88.2 bits (217), Expect = 3.7e-17 Identity = 39/66 (59.09%), Postives = 49/66 (74.24%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TrEMBL
Match: tr|A0A1S3BT39|A0A1S3BT39_CUCME (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103493239 PE=3 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.5e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TrEMBL
Match: tr|A0A1S3AUN1|A0A1S3AUN1_CUCME (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103483052 PE=3 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.5e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TrEMBL
Match: tr|A0A1S3AV92|A0A1S3AV92_CUCME (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103483048 PE=3 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.5e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TrEMBL
Match: tr|A0A0A0KPZ9|A0A0A0KPZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G136360 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.5e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of MELO3C035423.2.1 vs. TrEMBL
Match: tr|A0A0A0M006|A0A0A0M006_CUCSA (Beta-galactosidase OS=Cucumis sativus OX=3659 GN=Csa_1G650110 PE=3 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.5e-26 Identity = 59/66 (89.39%), Postives = 59/66 (89.39%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|