MELO3C035317.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ACAAGGGGTTCGATAGGAAAGTCCTTTCGATCCAATCAATTTTTTGAGTCAAATAAAGATAAAGGATATGTTAATGATCTAGCACAAGAAAGCACTCTCCGAGGGCATGAAATGTCTAATTTTTCTTTCAAAGTCATTATAGGAATAGTAATGTCTTTCTTAAATTCTCCGACCGAAATACAAGAGAACTCCATTCAATTCTCGATGGAATCAGAGTTTTTCGAATTTTTCCTAGAACTAACAGATCATTTCAAGATCTTCTCTAAGACTCTAAGGTTCAATGTGACTATTGTCACTTTTGCCAAGACAAAAGATGAGACTTTACCACTGTAA ACAAGGGGTTCGATAGGAAAGTCCTTTCGATCCAATCAATTTTTTGAGTCAAATAAAGATAAAGGATATGTTAATGATCTAGCACAAGAAAGCACTCTCCGAGGGCATGAAATGTCTAATTTTTCTTTCAAAGTCATTATAGGAATAGTAATGTCTTTCTTAAATTCTCCGACCGAAATACAAGAGAACTCCATTCAATTCTCGATGGAATCAGAGTTTTTCGAATTTTTCCTAGAACTAACAGATCATTTCAAGATCTTCTCTAAGACTCTAAGGTTCAATGTGACTATTGTCACTTTTGCCAAGACAAAAGATGAGACTTTACCACTGTAA ACAAGGGGTTCGATAGGAAAGTCCTTTCGATCCAATCAATTTTTTGAGTCAAATAAAGATAAAGGATATGTTAATGATCTAGCACAAGAAAGCACTCTCCGAGGGCATGAAATGTCTAATTTTTCTTTCAAAGTCATTATAGGAATAGTAATGTCTTTCTTAAATTCTCCGACCGAAATACAAGAGAACTCCATTCAATTCTCGATGGAATCAGAGTTTTTCGAATTTTTCCTAGAACTAACAGATCATTTCAAGATCTTCTCTAAGACTCTAAGGTTCAATGTGACTATTGTCACTTTTGCCAAGACAAAAGATGAGACTTTACCACTGTAA TRGSIGKSFRSNQFFESNKDKGYVNDLAQESTLRGHEMSNFSFKVIIGIVMSFLNSPTEIQENSIQFSMESEFFEFFLELTDHFKIFSKTLRFNVTIVTFAKTKDETLPL
BLAST of MELO3C035317.2.1 vs. NCBI nr
Match: AEN56134.1 (ribosomal protein L5 (mitochondrion) [Cucumis melo subsp. melo]) HSP 1 Score: 181.0 bits (458), Expect = 2.2e-42 Identity = 92/109 (84.40%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. NCBI nr
Match: YP_004849341.1 (ribosomal protein L5 (mitochondrion) [Cucumis sativus] >ADZ10768.1 ribosomal protein L5 (mitochondrion) [Cucumis sativus]) HSP 1 Score: 166.0 bits (419), Expect = 7.2e-38 Identity = 85/109 (77.98%), Postives = 96/109 (88.07%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. NCBI nr
Match: AAP33159.1 (ribosomal protein L5 (mitochondrion) [Cucumis sativus] >AAP33161.1 ribosomal protein L5 (mitochondrion) [Cucumis sativus] >AAP33162.1 ribosomal protein L5 (mitochondrion) [Cucumis sativus]) HSP 1 Score: 163.3 bits (412), Expect = 4.6e-37 Identity = 85/110 (77.27%), Postives = 96/110 (87.27%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. NCBI nr
Match: AFY03535.1 (ribosomal protein L5, partial (mitochondrion) [Lagenaria siceraria]) HSP 1 Score: 142.9 bits (359), Expect = 6.5e-31 Identity = 79/108 (73.15%), Postives = 87/108 (80.56%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. NCBI nr
Match: YP_002608355.1 (ribosomal protein L5 [Vitis vinifera] >CAQ77587.1 ribosomal protein L5 (mitochondrion) [Vitis vinifera] >ACS15246.1 ribosomal protein L5 (mitochondrion) [Vitis vinifera]) HSP 1 Score: 142.1 bits (357), Expect = 1.1e-30 Identity = 79/108 (73.15%), Postives = 87/108 (80.56%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. TAIR10
Match: AT2G07725.1 (Ribosomal L5P family protein) HSP 1 Score: 135.2 bits (339), Expect = 2.5e-32 Identity = 75/109 (68.81%), Postives = 85/109 (77.98%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. TAIR10
Match: ATMG00210.1 (ribosomal protein L5) HSP 1 Score: 135.2 bits (339), Expect = 2.5e-32 Identity = 75/109 (68.81%), Postives = 85/109 (77.98%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. Swiss-Prot
Match: sp|P49388|RM05_BRANA (60S ribosomal protein L5, mitochondrial OS=Brassica napus OX=3708 GN=RPL5 PE=3 SV=2) HSP 1 Score: 134.4 bits (337), Expect = 7.6e-31 Identity = 75/109 (68.81%), Postives = 85/109 (77.98%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. Swiss-Prot
Match: sp|Q05492|RM05_OENBE (60S ribosomal protein L5, mitochondrial OS=Oenothera berteroana OX=3950 GN=RPL5 PE=2 SV=2) HSP 1 Score: 133.3 bits (334), Expect = 1.7e-30 Identity = 74/109 (67.89%), Postives = 85/109 (77.98%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. Swiss-Prot
Match: sp|P42793|RM05_ARATH (60S ribosomal protein L5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPL5 PE=2 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 2.4e-29 Identity = 71/109 (65.14%), Postives = 84/109 (77.06%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. Swiss-Prot
Match: sp|P51409|RM05_SOLTU (60S ribosomal protein L5, mitochondrial OS=Solanum tuberosum OX=4113 GN=RPL5 PE=2 SV=2) HSP 1 Score: 121.7 bits (304), Expect = 5.1e-27 Identity = 73/110 (66.36%), Postives = 82/110 (74.55%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. Swiss-Prot
Match: sp|P26860|RM05_MARPO (60S ribosomal protein L5, mitochondrial OS=Marchantia polymorpha OX=3197 GN=RPL5 PE=3 SV=2) HSP 1 Score: 93.2 bits (230), Expect = 1.9e-18 Identity = 58/113 (51.33%), Postives = 75/113 (66.37%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. TrEMBL
Match: tr|G3EU44|G3EU44_CUCME (Ribosomal protein L5 OS=Cucumis melo subsp. melo OX=412675 GN=rpl5 PE=4 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 1.4e-42 Identity = 92/109 (84.40%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. TrEMBL
Match: tr|G3EIZ3|G3EIZ3_CUCSA (Ribosomal protein L5 OS=Cucumis sativus OX=3659 GN=rpl5 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 4.7e-38 Identity = 85/109 (77.98%), Postives = 96/109 (88.07%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. TrEMBL
Match: tr|Q7Y6H0|Q7Y6H0_CUCSA (Ribosomal protein L5 OS=Cucumis sativus OX=3659 GN=rpl5 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 3.1e-37 Identity = 85/110 (77.27%), Postives = 96/110 (87.27%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. TrEMBL
Match: tr|K7Z325|K7Z325_LAGSI (Ribosomal protein L5 (Fragment) OS=Lagenaria siceraria OX=3668 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 4.3e-31 Identity = 79/108 (73.15%), Postives = 87/108 (80.56%), Query Frame = 0
BLAST of MELO3C035317.2.1 vs. TrEMBL
Match: tr|B6VJT5|B6VJT5_VITVI (Ribosomal protein L5 OS=Vitis vinifera OX=29760 GN=rpl5 PE=4 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 7.3e-31 Identity = 79/108 (73.15%), Postives = 87/108 (80.56%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|