MELO3C034869.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGACACCATTTTCGTACCTGGACACGCTTTTGATTTTAAAATCGATGGGCATGGTGGCGGAGGGAATTCGTCGACGACGGATAGGGAATTGGTGACACTTTGTTTGAAGTTTTTGAACGACAGGACGGACACGACGGAGACAGTGATAAAGTGGGGGATGACAGAATTGATAGCGAATGAGGAAGTTTAGAGGAATATTGTGGAAGAAATTAAAGAGATGGTTGGTGAGAGA ATGTGACACCATTTTCGTACCTGGACACGCTTTTGATTTTAAAATCGATGGGCATGGTGGCGGAGGGAATTCGTCGACGACGGATAGGGAATTGGTGACACTTTGTTTGAAGTTTTTGAACGACAGGACGGACACGACGGAGACAGTGATAAAGTGGGGGATGACAGAATTGATAGCGAATGAGGAAGTTTAGAGGAATATTGTGGAAGAAATTAAAGAGATGGTTGGTGAGAGA TGTGACACCATTTTCGTACCTGGACACGCTTTTGATTTTAAAATCGATGGGCATGGTGGCGGAGGGAATTCGTCGACGACGGATAGGGAATTGGTGACACTTTGTTTGAAGTTTTTGAACGACAGGACGGACACGACGGAGACAGTGATAAAGTGGGGGATGACAGAATTGATAGCGAATGAGGAAGTTTAG CDTIFVPGHAFDFKIDGHGGGGNSSTTDRELVTLCLKFLNDRTDTTETVIKWGMTELIANEEV
BLAST of MELO3C034869.2.1 vs. NCBI nr
Match: XP_008446777.2 (PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis melo]) HSP 1 Score: 85.1 bits (209), Expect = 9.2e-14 Identity = 39/53 (73.58%), Postives = 44/53 (83.02%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. NCBI nr
Match: XP_011655840.1 (PREDICTED: cytochrome P450 77A3-like [Cucumis sativus] >KGN52206.1 hypothetical protein Csa_5G615280 [Cucumis sativus]) HSP 1 Score: 80.5 bits (197), Expect = 2.3e-12 Identity = 40/54 (74.07%), Postives = 44/54 (81.48%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. NCBI nr
Match: XP_018853421.1 (PREDICTED: cytochrome P450 77A3-like [Juglans regia]) HSP 1 Score: 62.0 bits (149), Expect = 8.3e-07 Identity = 31/53 (58.49%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. NCBI nr
Match: XP_022957595.1 (cytochrome P450 77A3-like [Cucurbita moschata]) HSP 1 Score: 62.0 bits (149), Expect = 8.3e-07 Identity = 31/53 (58.49%), Postives = 36/53 (67.92%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. NCBI nr
Match: XP_022984653.1 (cytochrome P450 77A3-like [Cucurbita maxima]) HSP 1 Score: 62.0 bits (149), Expect = 8.3e-07 Identity = 31/53 (58.49%), Postives = 36/53 (67.92%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TAIR10
Match: AT5G04630.1 (cytochrome P450, family 77, subfamily A, polypeptide 9) HSP 1 Score: 56.2 bits (134), Expect = 8.3e-09 Identity = 26/53 (49.06%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TAIR10
Match: AT5G04660.1 (cytochrome P450, family 77, subfamily A, polypeptide 4) HSP 1 Score: 56.2 bits (134), Expect = 8.3e-09 Identity = 27/53 (50.94%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TAIR10
Match: AT3G10560.1 (Cytochrome P450 superfamily protein) HSP 1 Score: 52.4 bits (124), Expect = 1.2e-07 Identity = 23/43 (53.49%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TAIR10
Match: AT3G10570.1 (cytochrome P450, family 77, subfamily A, polypeptide 6) HSP 1 Score: 50.1 bits (118), Expect = 6.0e-07 Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TAIR10
Match: AT2G12190.1 (Cytochrome P450 superfamily protein) HSP 1 Score: 41.6 bits (96), Expect = 2.1e-04 Identity = 17/34 (50.00%), Postives = 24/34 (70.59%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. Swiss-Prot
Match: sp|Q9LZ31|C77A4_ARATH (Cytochrome P450 77A4 OS=Arabidopsis thaliana OX=3702 GN=CYP77A4 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.5e-07 Identity = 27/53 (50.94%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. Swiss-Prot
Match: sp|O48928|C77A3_SOYBN (Cytochrome P450 77A3 OS=Glycine max OX=3847 GN=CYP77A3 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 3.3e-07 Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. Swiss-Prot
Match: sp|P37124|C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena OX=4111 GN=CYP77A2 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 3.7e-06 Identity = 27/53 (50.94%), Postives = 33/53 (62.26%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. Swiss-Prot
Match: sp|P37123|C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena OX=4111 GN=CYP77A1 PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.1e-05 Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TrEMBL
Match: tr|A0A1S3BGP7|A0A1S3BGP7_CUCME (LOW QUALITY PROTEIN: cytochrome P450 77A3-like OS=Cucumis melo OX=3656 GN=LOC103489405 PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 6.1e-14 Identity = 39/53 (73.58%), Postives = 44/53 (83.02%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TrEMBL
Match: tr|A0A0A0KWN5|A0A0A0KWN5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G615280 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.5e-12 Identity = 40/54 (74.07%), Postives = 44/54 (81.48%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TrEMBL
Match: tr|A0A2I4HB86|A0A2I4HB86_9ROSI (cytochrome P450 77A3-like OS=Juglans regia OX=51240 GN=LOC109015403 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 5.5e-07 Identity = 31/53 (58.49%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TrEMBL
Match: tr|A0A0L9TZ26|A0A0L9TZ26_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan02g180200 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.7e-06 Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of MELO3C034869.2.1 vs. TrEMBL
Match: tr|A0A0S3SP59|A0A0S3SP59_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.08G116800 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.7e-06 Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|