MELO3C031612.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATTTTGAAGTTTATTTCATTTGATAGTTATTCTTCAAATACGCATAAATCAATCAATGGTCTTTGTTCTATTGAAAATAAAGAATCGATTATAAATAATATGAATAAAAGCATTCCTAATTATAGTGATAGTTATAGTATTGTTGATGATTTAGTCGGCATTCGTAATTTCAAGTCTAATGACAATTTTTTAGTTAGGGATAGTAACTGCCGTAGTTATTCCATCTATTTGGATATTGCAAATCAAATTTTTGAGATTAACAATTATCCTTCATTTATGAGTGAACTAAAAAATTCTTTTTATAGTTTTCGGAACTCTACTTATCAAAACAATGTATCTAAGAGAGATGATTTCCACTGCAATCATTACATGTATGATACTAAATATATAGTGTCACATTAATAATTTCATTGATAGTTATAATTGAATTCAAATACTTATTGATAGTTTACATTTTAAGTAGTAGTCACAATAACAGTTACATTTATAATTATATTTGTGGTGAAGGTGGAAATAGTAATGAAA ATTTTGAAGTTTATTTCATTTGATAGTTATTCTTCAAATACGCATAAATCAATCAATGGTCTTTGTTCTATTGAAAATAAAGAATCGATTATAAATAATATGAATAAAAGCATTCCTAATTATAGTGATAGTTATAGTATTGTTGATGATTTAGTCGGCATTCGTAATTTCAAGTCTAATGACAATTTTTTAGTTAGGGATAGTAACTGCCGTAGTTATTCCATCTATTTGGATATTGCAAATCAAATTTTTGAGATTAACAATTATCCTTCATTTATGAGTGAACTAAAAAATTCTTTTTATAGTTTTCGGAACTCTACTTATCAAAACAATGTATCTAAGAGAGATGATTTCCACTGCAATCATTACATGTATGATACTAAATATATAGTGTCACATTAATAATTTCATTGATAGTTATAATTGAATTCAAATACTTATTGATAGTTTACATTTTAAGTAGTAGTCACAATAACAGTTACATTTATAATTATATTTGTGGTGAAGGTGGAAATAGTAATGAAA ATTTTGAAGTTTATTTCATTTGATAGTTATTCTTCAAATACGCATAAATCAATCAATGGTCTTTGTTCTATTGAAAATAAAGAATCGATTATAAATAATATGAATAAAAGCATTCCTAATTATAGTGATAGTTATAGTATTGTTGATGATTTAGTCGGCATTCGTAATTTCAAGTCTAATGACAATTTTTTAGTTAGGGATAGTAACTGCCGTAGTTATTCCATCTATTTGGATATTGCAAATCAAATTTTTGAGATTAACAATTATCCTTCATTTATGAGTGAACTAAAAAATTCTTTTTATAGTTTTCGGAACTCTACTTATCAAAACAATGTATCTAAGAGAGATGATTTCCACTGCAATCATTACATGTATGATACTAAATATATAGTGTCACATTAA ILKFISFDSYSSNTHKSINGLCSIENKESIINNMNKSIPNYSDSYSIVDDLVGIRNFKSNDNFLVRDSNCRSYSIYLDIANQIFEINNYPSFMSELKNSFYSFRNSTYQNNVSKRDDFHCNHYMYDTKYIVSH
BLAST of MELO3C031612.2.1 vs. NCBI nr
Match: YP_247608.1 (acetyl-CoA carboxylase beta subunit [Cucumis sativus] >CAJ00767.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis sativus]) HSP 1 Score: 162.9 bits (411), Expect = 7.3e-37 Identity = 88/124 (70.97%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. NCBI nr
Match: YP_009004053.1 (Acetyl-CoA carboxylase carboxyltransferase beta subunit [Cucumis hystrix] >Q2QD80.2 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic; Short=ACCase subunit beta; Short=Acetyl-CoA carboxylase carboxyltransferase subunit beta >ABI97426.1 acetyl-CoA carboxylase carboxyltransferase beta subunit (chloroplast) [Cucumis sativus] >ABI98754.1 acetyl-CoA carboxylase carboxyltransferase beta subunit (chloroplast) [Cucumis sativus] >AHJ61395.1 Acetyl-CoA carboxylase carboxyltransferase beta subunit (plastid) [Cucumis hystrix] >ALF03310.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis sativus var. hardwickii] >ANF28386.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis sativus var. hardwickii] >ARQ16087.1 acetyl-CoA carboxylase carboxyltransferase beta subunit (chloroplast) [Cucumis sativus] >ARQ16170.1 acetyl-CoA carboxylase carboxyltransferase beta subunit (chloroplast) [Cucumis sativus] >ARQ16253.1 acetyl-CoA carboxylase carboxyltransferase beta subunit (chloroplast) [Cucumis sativus] >ARQ16336.1 acetyl-CoA carboxylase carboxyltransferase beta subunit (chloroplast) [Cucumis sativus] >ASY97450.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Cucumis sativus var. hardwickii] >AVE15340.1 AccD (chloroplast) [Cucumis sativus var. sativus]) HSP 1 Score: 162.9 bits (411), Expect = 7.3e-37 Identity = 88/124 (70.97%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. NCBI nr
Match: YP_009325998.1 (acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus lanatus] >YP_009348040.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus mucosospermus] >YP_009431566.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus amarus] >APD52489.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus lanatus] >APW82470.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82555.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82640.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82725.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus mucosospermus] >APW82810.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus mucosospermus] >APW82895.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82980.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83065.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83150.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83235.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83320.1 acetyl-CoA carboxylase beta subunit (plastid) [Citrullus mucosospermus] >ASY96155.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus amarus]) HSP 1 Score: 162.9 bits (411), Expect = 7.3e-37 Identity = 89/124 (71.77%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. NCBI nr
Match: YP_009420803.1 (acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus colocynthis] >ASP44504.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus colocynthis]) HSP 1 Score: 162.9 bits (411), Expect = 7.3e-37 Identity = 89/124 (71.77%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. NCBI nr
Match: YP_009431651.1 (acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus rehmii] >ASY96240.1 acetyl-CoA carboxylase beta subunit (chloroplast) [Citrullus rehmii]) HSP 1 Score: 162.9 bits (411), Expect = 7.3e-37 Identity = 89/124 (71.77%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. TAIR10
Match: ATCG00500.1 (acetyl-CoA carboxylase carboxyl transferase subunit beta) HSP 1 Score: 71.6 bits (174), Expect = 4.0e-13 Identity = 48/95 (50.53%), Postives = 61/95 (64.21%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. Swiss-Prot
Match: sp|Q2QD80|ACCD_CUCSA (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis sativus OX=3659 GN=accD PE=3 SV=2) HSP 1 Score: 162.9 bits (411), Expect = 2.4e-39 Identity = 88/124 (70.97%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. Swiss-Prot
Match: sp|Q09X08|ACCD_MORIN (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Morus indica OX=248361 GN=accD PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.8e-26 Identity = 76/132 (57.58%), Postives = 93/132 (70.45%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. Swiss-Prot
Match: sp|B1A944|ACCD_CARPA (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Carica papaya OX=3649 GN=accD PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 3.1e-23 Identity = 71/132 (53.79%), Postives = 87/132 (65.91%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. Swiss-Prot
Match: sp|Q68RZ7|ACCD_PANGI (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Panax ginseng OX=4054 GN=accD PE=3 SV=2) HSP 1 Score: 109.0 bits (271), Expect = 4.1e-23 Identity = 67/125 (53.60%), Postives = 86/125 (68.80%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. Swiss-Prot
Match: sp|Q8S8W7|ACCD_ATRBE (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Atropa belladonna OX=33113 GN=accD PE=3 SV=2) HSP 1 Score: 96.3 bits (238), Expect = 2.8e-19 Identity = 63/118 (53.39%), Postives = 77/118 (65.25%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. TrEMBL
Match: tr|A0A1P8LF62|A0A1P8LF62_CITLA (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=accD PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 4.9e-37 Identity = 89/124 (71.77%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. TrEMBL
Match: tr|A0A218KG54|A0A218KG54_CUCSA (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=accD PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 4.9e-37 Identity = 88/124 (70.97%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. TrEMBL
Match: tr|A0A1X9Q1V0|A0A1X9Q1V0_CUCSA (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis sativus OX=3659 GN=accD PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 4.9e-37 Identity = 88/124 (70.97%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. TrEMBL
Match: tr|A0A1P8LFN2|A0A1P8LFN2_9ROSI (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Citrullus mucosospermus OX=519315 GN=accD PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 4.9e-37 Identity = 89/124 (71.77%), Postives = 100/124 (80.65%), Query Frame = 0
BLAST of MELO3C031612.2.1 vs. TrEMBL
Match: tr|W8E133|W8E133_9ROSI (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta OS=Cucumis hystrix OX=396994 GN=accD PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 4.9e-37 Identity = 88/124 (70.97%), Postives = 100/124 (80.65%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|