MELO3C030593.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ACCATTACTTTAATGCAAGAGAAATTTATAGTGTGCATCGTGTGTATGTGTTGCTCCTACGTGTGGATGACTGAATTTGGAAAATTTTCATATTACTATGCTTGTAAAGATTTTAGCCTCTCTAGATTTGCTCAGGCATGTTCTCCTATTGATTCTTCAATTTCTTGCTAG ACCATTACTTTAATGCAAGAGAAATTTATAGTGTGCATCGTGTGTATGTGTTGCTCCTACGTGTGGATGACTGAATTTGGAAAATTTTCATATTACTATGCTTGTAAAGATTTTAGCCTCTCTAGATTTGCTCAGGCATGTTCTCCTATTGATTCTTCAATTTCTTGCTAG ATGCAAGAGAAATTTATAGTGTGCATCGTGTGTATGTGTTGCTCCTACGTGTGGATGACTGAATTTGGAAAATTTTCATATTACTATGCTTGTAAAGATTTTAGCCTCTCTAGATTTGCTCAGGCATGTTCTCCTATTGATTCTTCAATTTCTTGCTAG MQEKFIVCIVCMCCSYVWMTEFGKFSYYYACKDFSLSRFAQACSPIDSSISC
BLAST of MELO3C030593.2.1 vs. NCBI nr
Match: KGN47447.1 (hypothetical protein Csa_6G325400 [Cucumis sativus]) HSP 1 Score: 72.0 bits (175), Expect = 6.7e-10 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. NCBI nr
Match: XP_011461723.1 (PREDICTED: LOW QUALITY PROTEIN: CAS1 domain-containing protein 1 [Fragaria vesca subsp. vesca]) HSP 1 Score: 52.4 bits (124), Expect = 5.5e-04 Identity = 25/42 (59.52%), Postives = 28/42 (66.67%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. NCBI nr
Match: XP_015936787.1 (protein REDUCED WALL ACETYLATION 2 isoform X1 [Arachis duranensis] >XP_025610057.1 protein REDUCED WALL ACETYLATION 2-like isoform X1 [Arachis hypogaea]) HSP 1 Score: 51.6 bits (122), Expect = 9.3e-04 Identity = 22/29 (75.86%), Postives = 24/29 (82.76%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. NCBI nr
Match: XP_015936800.1 (protein REDUCED WALL ACETYLATION 2 isoform X2 [Arachis duranensis] >XP_025610062.1 protein REDUCED WALL ACETYLATION 2-like isoform X2 [Arachis hypogaea]) HSP 1 Score: 51.6 bits (122), Expect = 9.3e-04 Identity = 22/29 (75.86%), Postives = 24/29 (82.76%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. TAIR10
Match: AT5G46340.1 (O-acetyltransferase family protein) HSP 1 Score: 47.4 bits (111), Expect = 3.2e-06 Identity = 20/27 (74.07%), Postives = 23/27 (85.19%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. TAIR10
Match: AT3G06550.2 (O-acetyltransferase family protein) HSP 1 Score: 47.0 bits (110), Expect = 4.2e-06 Identity = 24/37 (64.86%), Postives = 25/37 (67.57%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. TAIR10
Match: AT2G34410.1 (O-acetyltransferase family protein) HSP 1 Score: 46.6 bits (109), Expect = 5.4e-06 Identity = 20/27 (74.07%), Postives = 22/27 (81.48%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. TAIR10
Match: AT1G29890.2 (O-acetyltransferase family protein) HSP 1 Score: 45.4 bits (106), Expect = 1.2e-05 Identity = 24/43 (55.81%), Postives = 26/43 (60.47%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. Swiss-Prot
Match: sp|Q8L7C8|RWA1_ARATH (Protein REDUCED WALL ACETYLATION 1 OS=Arabidopsis thaliana OX=3702 GN=RWA1 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 5.7e-05 Identity = 20/27 (74.07%), Postives = 23/27 (85.19%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. Swiss-Prot
Match: sp|Q0WW17|RWA2_ARATH (Protein REDUCED WALL ACETYLATION 2 OS=Arabidopsis thaliana OX=3702 GN=RWA2 PE=1 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 7.5e-05 Identity = 24/37 (64.86%), Postives = 25/37 (67.57%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. Swiss-Prot
Match: sp|Q66GQ5|RWA3_ARATH (Protein REDUCED WALL ACETYLATION 3 OS=Arabidopsis thaliana OX=3702 GN=RWA3 PE=1 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 9.8e-05 Identity = 20/27 (74.07%), Postives = 22/27 (81.48%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. Swiss-Prot
Match: sp|Q9FXG3|RWA4_ARATH (Protein REDUCED WALL ACETYLATION 4 OS=Arabidopsis thaliana OX=3702 GN=RWA4 PE=2 SV=2) HSP 1 Score: 44.3 bits (103), Expect = 4.9e-04 Identity = 22/38 (57.89%), Postives = 24/38 (63.16%), Query Frame = 0
BLAST of MELO3C030593.2.1 vs. TrEMBL
Match: tr|A0A0A0KGC4|A0A0A0KGC4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G325400 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.4e-10 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|