MELO3C026989.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAGCACTTTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGTCAAACAAATTGAGGATGAAAAAACAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATATGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTCTGTGGTTTATGTTAACTTTGGTAGCATCATAGTGATGACAAAACAAGTAGTACTGAAGTTTCGGGCGCAAAAACCCCACATGGAAGAACATTAA ATGGCTAGCACTTTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGTCAAACAAATTGAGGATGAAAAAACAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATATGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTCTGTGGTTTATGTTAACTTTGGTAGCATCATAGTGATGACAAAACAAGTAGTACTGAAGTTTCGGGCGCAAAAACCCCACATGGAAGAACATTAA ATGGCTAGCACTTTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGTCAAACAAATTGAGGATGAAAAAACAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATATGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTCTGTGGTTTATGTTAACTTTGGTAGCATCATAGTGATGACAAAACAAGTAGTACTGAAGTTTCGGGCGCAAAAACCCCACATGGAAGAACATTAA MASTFPFSNPHHYTVGPLHMMVKQIEDEKTRAVGSNLWVEEYECIEWLNSKEPNSVVYVNFGSIIVMTKQVVLKFRAQKPHMEEH
BLAST of MELO3C026989.2.1 vs. NCBI nr
Match: XP_008455194.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 136.0 bits (341), Expect = 6.1e-29 Identity = 63/75 (84.00%), Postives = 69/75 (92.00%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. NCBI nr
Match: XP_016901691.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 135.6 bits (340), Expect = 8.0e-29 Identity = 62/75 (82.67%), Postives = 70/75 (93.33%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. NCBI nr
Match: XP_008455180.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 134.4 bits (337), Expect = 1.8e-28 Identity = 61/75 (81.33%), Postives = 68/75 (90.67%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. NCBI nr
Match: XP_011659716.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 4.4e-27 Identity = 61/76 (80.26%), Postives = 68/76 (89.47%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. NCBI nr
Match: XP_011658788.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform X1 [Cucumis sativus]) HSP 1 Score: 125.6 bits (314), Expect = 8.3e-26 Identity = 57/76 (75.00%), Postives = 66/76 (86.84%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TAIR10
Match: AT1G22370.2 (UDP-glucosyl transferase 85A5) HSP 1 Score: 79.7 bits (195), Expect = 9.5e-16 Identity = 35/68 (51.47%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TAIR10
Match: AT1G22380.1 (UDP-glucosyl transferase 85A3) HSP 1 Score: 77.4 bits (189), Expect = 4.7e-15 Identity = 37/68 (54.41%), Postives = 48/68 (70.59%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TAIR10
Match: AT1G22360.1 (UDP-glucosyl transferase 85A2) HSP 1 Score: 74.7 bits (182), Expect = 3.0e-14 Identity = 35/68 (51.47%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TAIR10
Match: AT1G22340.1 (UDP-glucosyl transferase 85A7) HSP 1 Score: 70.9 bits (172), Expect = 4.4e-13 Identity = 32/68 (47.06%), Postives = 50/68 (73.53%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TAIR10
Match: AT1G22400.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 68.9 bits (167), Expect = 1.7e-12 Identity = 31/68 (45.59%), Postives = 51/68 (75.00%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. Swiss-Prot
Match: sp|Q6VAB3|U85A8_STERE (UDP-glycosyltransferase 85A8 OS=Stevia rebaudiana OX=55670 GN=UGT85A8 PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 3.3e-18 Identity = 40/68 (58.82%), Postives = 55/68 (80.88%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. Swiss-Prot
Match: sp|F8WKW1|UGT2_GARJA (7-deoxyloganetin glucosyltransferase OS=Gardenia jasminoides OX=114476 GN=UGT85A24 PE=1 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.8e-17 Identity = 38/66 (57.58%), Postives = 52/66 (78.79%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. Swiss-Prot
Match: sp|F8WLS6|UGT6_CATRO (7-deoxyloganetin glucosyltransferase OS=Catharanthus roseus OX=4058 GN=UGT85A23 PE=1 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 6.3e-17 Identity = 37/66 (56.06%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. Swiss-Prot
Match: sp|Q6VAA4|U85C1_STERE (UDP-glycosyltransferase 85C1 OS=Stevia rebaudiana OX=55670 GN=UGT85C1 PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.6e-15 Identity = 36/66 (54.55%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. Swiss-Prot
Match: sp|Q9LMF0|U85A5_ARATH (UDP-glycosyltransferase 85A5 OS=Arabidopsis thaliana OX=3702 GN=UGT85A5 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.7e-14 Identity = 35/68 (51.47%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TrEMBL
Match: tr|A0A1S3C0B9|A0A1S3C0B9_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495416 PE=3 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 4.1e-29 Identity = 63/75 (84.00%), Postives = 69/75 (92.00%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TrEMBL
Match: tr|A0A1S4E0D7|A0A1S4E0D7_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495415 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 5.3e-29 Identity = 62/75 (82.67%), Postives = 70/75 (93.33%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TrEMBL
Match: tr|A0A1S3C1J4|A0A1S3C1J4_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495412 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 1.2e-28 Identity = 61/75 (81.33%), Postives = 68/75 (90.67%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TrEMBL
Match: tr|A0A0A0K416|A0A0A0K416_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G063980 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.2e-19 Identity = 44/63 (69.84%), Postives = 56/63 (88.89%), Query Frame = 0
BLAST of MELO3C026989.2.1 vs. TrEMBL
Match: tr|A0A1S3C117|A0A1S3C117_CUCME (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495410 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 3.8e-19 Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|