MELO3C025820T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GTTATAACCTTAGATATGGGCCTTCTTGTAGCTGGCACAAAATATCGTGGGGAGTTTGAAGAAAGATTAAAGAAACTGATGGAGGAAATAAAACAAAGTGATGGAGCAGGGGCTGCAGAAGGAGCTATTGATGCAGCAAACATATTAAAACCTACCCTTGCAAGGGGTCAACTGCAGGTATTCTCGTAA GTTATAACCTTAGATATGGGCCTTCTTGTAGCTGGCACAAAATATCGTGGGGAGTTTGAAGAAAGATTAAAGAAACTGATGGAGGAAATAAAACAAAGTGATGGAGCAGGGGCTGCAGAAGGAGCTATTGATGCAGCAAACATATTAAAACCTACCCTTGCAAGGGGTCAACTGCAGGTATTCTCGTAA GTTATAACCTTAGATATGGGCCTTCTTGTAGCTGGCACAAAATATCGTGGGGAGTTTGAAGAAAGATTAAAGAAACTGATGGAGGAAATAAAACAAAGTGATGGAGCAGGGGCTGCAGAAGGAGCTATTGATGCAGCAAACATATTAAAACCTACCCTTGCAAGGGGTCAACTGCAGGTATTCTCGTAA VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDGAGAAEGAIDAANILKPTLARGQLQVFS*
BLAST of MELO3C025820T1 vs. Swiss-Prot
Match: CLPC2_ORYSJ (Chaperone protein ClpC2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC2 PE=2 SV=2) HSP 1 Score: 103.2 bits (256), Expect = 1.1e-21 Identity = 57/72 (79.17%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of MELO3C025820T1 vs. Swiss-Prot
Match: CLPC_PEA (Chaperone protein ClpC, chloroplastic OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.1e-21 Identity = 57/72 (79.17%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of MELO3C025820T1 vs. Swiss-Prot
Match: CLPAA_SOLLC (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4A, chloroplastic OS=Solanum lycopersicum GN=CD4A PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.1e-21 Identity = 57/72 (79.17%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of MELO3C025820T1 vs. Swiss-Prot
Match: CLPAB_SOLLC (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic OS=Solanum lycopersicum GN=CD4B PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.1e-21 Identity = 57/72 (79.17%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of MELO3C025820T1 vs. Swiss-Prot
Match: CLPC1_ORYSJ (Chaperone protein ClpC1, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC1 PE=2 SV=2) HSP 1 Score: 102.1 bits (253), Expect = 2.3e-21 Identity = 56/72 (77.78%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TrEMBL
Match: W5GM60_WHEAT (Uncharacterized protein OS=Triticum aestivum PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 9.0e-20 Identity = 57/73 (78.08%), Postives = 59/73 (80.82%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TrEMBL
Match: A0A067EBP2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g003094mg PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 9.0e-20 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TrEMBL
Match: V4TAC3_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina GN=CICLE_v100308631mg PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 9.0e-20 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TrEMBL
Match: A0A067EK53_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g003094mg PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 9.0e-20 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TrEMBL
Match: M7Z383_TRIUA (ATP-dependent Clp protease ATP-binding subunit clpA-like protein CD4B, chloroplastic OS=Triticum urartu GN=TRIUR3_18196 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 9.0e-20 Identity = 57/73 (78.08%), Postives = 59/73 (80.82%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TAIR10
Match: AT3G48870.1 (AT3G48870.1 Clp ATPase) HSP 1 Score: 102.1 bits (253), Expect = 1.3e-22 Identity = 56/72 (77.78%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TAIR10
Match: AT5G50920.1 (AT5G50920.1 CLPC homologue 1) HSP 1 Score: 102.1 bits (253), Expect = 1.3e-22 Identity = 56/72 (77.78%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TAIR10
Match: AT1G74310.1 (AT1G74310.1 heat shock protein 101) HSP 1 Score: 75.1 bits (183), Expect = 1.7e-14 Identity = 38/73 (52.05%), Postives = 49/73 (67.12%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TAIR10
Match: AT5G15450.1 (AT5G15450.1 casein lytic proteinase B3) HSP 1 Score: 72.0 bits (175), Expect = 1.5e-13 Identity = 36/73 (49.32%), Postives = 47/73 (64.38%), Query Frame = 1
BLAST of MELO3C025820T1 vs. TAIR10
Match: AT2G25140.1 (AT2G25140.1 casein lytic proteinase B4) HSP 1 Score: 70.9 bits (172), Expect = 3.3e-13 Identity = 36/73 (49.32%), Postives = 49/73 (67.12%), Query Frame = 1
BLAST of MELO3C025820T1 vs. NCBI nr
Match: gi|848906978|ref|XP_012852691.1| (PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic [Erythranthe guttata]) HSP 1 Score: 104.8 bits (260), Expect = 5.8e-20 Identity = 58/73 (79.45%), Postives = 59/73 (80.82%), Query Frame = 1
BLAST of MELO3C025820T1 vs. NCBI nr
Match: gi|641832252|gb|KDO51291.1| (hypothetical protein CISIN_1g003094mg [Citrus sinensis]) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-19 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of MELO3C025820T1 vs. NCBI nr
Match: gi|474072491|gb|EMS54417.1| (ATP-dependent Clp protease ATP-binding subunit clpA-like protein CD4B, chloroplastic [Triticum urartu]) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-19 Identity = 57/73 (78.08%), Postives = 59/73 (80.82%), Query Frame = 1
BLAST of MELO3C025820T1 vs. NCBI nr
Match: gi|568863336|ref|XP_006485108.1| (PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic [Citrus sinensis]) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-19 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
BLAST of MELO3C025820T1 vs. NCBI nr
Match: gi|641832251|gb|KDO51290.1| (hypothetical protein CISIN_1g003094mg [Citrus sinensis]) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-19 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|