MELO3C024421T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACACCAGAAAGGAAGAAAAGCAATAACAATATCATCATTCCAATAGTAGCATCGGTGGGTGGATTGCTTGCATTCCTCATAATTGCAGCAATTATTTATTTGATTTCTAAATCAAATAAGAAACAACAAGATAAGCATGTTTCTTTGACAAAGGATCCGGCAAAGACAAACACTCATTTAGGCAGTTTATTGGAGAAAAGGAGACATCAGTTCACTTATGCGGAAGTTGTGGTGATGACCAACAATTTTGAGAAAATTCTGGGTAAAGGAGGTTTTGGGATGGTTTACTATGGAGTTCTAGATGACACTCAAGTGGCTGTGAAGATGATTTCTCCATCAGCAGTACAAGGCTACCATCAGTTTCAAGCAGAGGCATGA ATGACACCAGAAAGGAAGAAAAGCAATAACAATATCATCATTCCAATAGTAGCATCGGTGGGTGGATTGCTTGCATTCCTCATAATTGCAGCAATTATTTATTTGATTTCTAAATCAAATAAGAAACAACAAGATAAGCATGTTTCTTTGACAAAGGATCCGGCAAAGACAAACACTCATTTAGGCAGTTTATTGGAGAAAAGGAGACATCAGTTCACTTATGCGGAAGTTGTGGTGATGACCAACAATTTTGAGAAAATTCTGGGTAAAGGAGGTTTTGGGATGGTTTACTATGGAGTTCTAGATGACACTCAAGTGGCTGTGAAGATGATTTCTCCATCAGCAGTACAAGGCTACCATCAGTTTCAAGCAGAGGCATGA ATGACACCAGAAAGGAAGAAAAGCAATAACAATATCATCATTCCAATAGTAGCATCGGTGGGTGGATTGCTTGCATTCCTCATAATTGCAGCAATTATTTATTTGATTTCTAAATCAAATAAGAAACAACAAGATAAGCATGTTTCTTTGACAAAGGATCCGGCAAAGACAAACACTCATTTAGGCAGTTTATTGGAGAAAAGGAGACATCAGTTCACTTATGCGGAAGTTGTGGTGATGACCAACAATTTTGAGAAAATTCTGGGTAAAGGAGGTTTTGGGATGGTTTACTATGGAGTTCTAGATGACACTCAAGTGGCTGTGAAGATGATTTCTCCATCAGCAGTACAAGGCTACCATCAGTTTCAAGCAGAGGCATGA MTPERKKSNNNIIIPIVASVGGLLAFLIIAAIIYLISKSNKKQQDKHVSLTKDPAKTNTHLGSLLEKRRHQFTYAEVVVMTNNFEKILGKGGFGMVYYGVLDDTQVAVKMISPSAVQGYHQFQAEA*
BLAST of MELO3C024421T1 vs. Swiss-Prot
Match: Y5181_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g51810 OS=Arabidopsis thaliana GN=At1g51810 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 9.5e-22 Identity = 56/116 (48.28%), Postives = 81/116 (69.83%), Query Frame = 1
BLAST of MELO3C024421T1 vs. Swiss-Prot
Match: Y5188_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.6e-21 Identity = 58/119 (48.74%), Postives = 76/119 (63.87%), Query Frame = 1
BLAST of MELO3C024421T1 vs. Swiss-Prot
Match: Y5189_ARATH (Probable LRR receptor-like protein kinase At1g51890 OS=Arabidopsis thaliana GN=At1g51890 PE=2 SV=2) HSP 1 Score: 102.4 bits (254), Expect = 3.6e-21 Identity = 57/125 (45.60%), Postives = 82/125 (65.60%), Query Frame = 1
BLAST of MELO3C024421T1 vs. Swiss-Prot
Match: Y1518_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g51860 OS=Arabidopsis thaliana GN=At1g51860 PE=2 SV=2) HSP 1 Score: 98.6 bits (244), Expect = 5.2e-20 Identity = 58/133 (43.61%), Postives = 82/133 (61.65%), Query Frame = 1
BLAST of MELO3C024421T1 vs. Swiss-Prot
Match: Y5573_ARATH (Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2) HSP 1 Score: 95.9 bits (237), Expect = 3.4e-19 Identity = 51/116 (43.97%), Postives = 76/116 (65.52%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TrEMBL
Match: A0A0A0KB14_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452170 PE=4 SV=1) HSP 1 Score: 233.8 bits (595), Expect = 1.2e-58 Identity = 119/126 (94.44%), Postives = 121/126 (96.03%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TrEMBL
Match: A0A0A0K7Y5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452180 PE=3 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 8.1e-44 Identity = 95/125 (76.00%), Postives = 106/125 (84.80%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TrEMBL
Match: A0A0A0K9P9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452140 PE=4 SV=1) HSP 1 Score: 183.3 bits (464), Expect = 1.8e-43 Identity = 96/125 (76.80%), Postives = 106/125 (84.80%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TrEMBL
Match: A0A0A0K792_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452200 PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 4.9e-33 Identity = 75/123 (60.98%), Postives = 93/123 (75.61%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TrEMBL
Match: A0A0A0K786_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452100 PE=3 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 1.6e-28 Identity = 67/123 (54.47%), Postives = 92/123 (74.80%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TAIR10
Match: AT1G51870.1 (AT1G51870.1 protein kinase family protein) HSP 1 Score: 110.5 bits (275), Expect = 7.5e-25 Identity = 59/129 (45.74%), Postives = 84/129 (65.12%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TAIR10
Match: AT1G51810.1 (AT1G51810.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 104.4 bits (259), Expect = 5.4e-23 Identity = 56/116 (48.28%), Postives = 81/116 (69.83%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TAIR10
Match: AT1G51880.1 (AT1G51880.1 root hair specific 6) HSP 1 Score: 102.4 bits (254), Expect = 2.0e-22 Identity = 58/119 (48.74%), Postives = 76/119 (63.87%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TAIR10
Match: AT1G51890.1 (AT1G51890.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 102.4 bits (254), Expect = 2.0e-22 Identity = 57/125 (45.60%), Postives = 82/125 (65.60%), Query Frame = 1
BLAST of MELO3C024421T1 vs. TAIR10
Match: AT1G51860.1 (AT1G51860.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 98.6 bits (244), Expect = 2.9e-21 Identity = 58/133 (43.61%), Postives = 82/133 (61.65%), Query Frame = 1
BLAST of MELO3C024421T1 vs. NCBI nr
Match: gi|659124866|ref|XP_008462387.1| (PREDICTED: probable LRR receptor-like protein kinase At1g51890 isoform X1 [Cucumis melo]) HSP 1 Score: 247.7 bits (631), Expect = 1.1e-62 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 1
BLAST of MELO3C024421T1 vs. NCBI nr
Match: gi|700190329|gb|KGN45562.1| (hypothetical protein Csa_7G452170 [Cucumis sativus]) HSP 1 Score: 233.8 bits (595), Expect = 1.7e-58 Identity = 119/126 (94.44%), Postives = 121/126 (96.03%), Query Frame = 1
BLAST of MELO3C024421T1 vs. NCBI nr
Match: gi|778730526|ref|XP_011659808.1| (PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g51880 [Cucumis sativus]) HSP 1 Score: 232.3 bits (591), Expect = 4.8e-58 Identity = 118/125 (94.40%), Postives = 120/125 (96.00%), Query Frame = 1
BLAST of MELO3C024421T1 vs. NCBI nr
Match: gi|659124868|ref|XP_008462388.1| (PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 isoform X2 [Cucumis melo]) HSP 1 Score: 188.7 bits (478), Expect = 6.1e-45 Identity = 98/125 (78.40%), Postives = 108/125 (86.40%), Query Frame = 1
BLAST of MELO3C024421T1 vs. NCBI nr
Match: gi|659125002|ref|XP_008462458.1| (PREDICTED: putative leucine-rich repeat receptor-like protein kinase At2g19210 [Cucumis melo]) HSP 1 Score: 186.4 bits (472), Expect = 3.0e-44 Identity = 98/125 (78.40%), Postives = 105/125 (84.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|