MELO3C022883T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAGTTCCTAAGGAGGTGCCTCTTGATATGCAGTGCAAGGATAAGTTCTTAATTCAAAGTGTTATTGTAGTACCCGATGGTACAACATCAAAATACATTAGTGCAGAATTGGTAGGAATGTCTTGTTGATTCTTTCTTTTGCTATGTAATTCTTTTTATCAATAATGATGTTATATTGTTGCTTATGTTTTGCATCTATGAAGTGTAGTTTAACAACGGAGATGGTAAGGTAGTTGAAGAGTTTAAGATGAGGGTTGTTTACATTTTTGCAAATCCTCTATTGCCTATCCCAGAAGGATTTGAAGAATGA ATGCAAGTTCCTAAGGAGGTGCCTCTTGATATGCAGTGCAAGGATAAGTTCTTAATTCAAAGTGTTATTGTAGTACCCGATGGTACAACATCAAAATACATTAGTGCAGAATTGTTTAACAACGGAGATGGTAAGGTAGTTGAAGAGTTTAAGATGAGGGTTGTTTACATTTTTGCAAATCCTCTATTGCCTATCCCAGAAGGATTTGAAGAATGA ATGCAAGTTCCTAAGGAGGTGCCTCTTGATATGCAGTGCAAGGATAAGTTCTTAATTCAAAGTGTTATTGTAGTACCCGATGGTACAACATCAAAATACATTAGTGCAGAATTGTTTAACAACGGAGATGGTAAGGTAGTTGAAGAGTTTAAGATGAGGGTTGTTTACATTTTTGCAAATCCTCTATTGCCTATCCCAGAAGGATTTGAAGAATGA MQVPKEVPLDMQCKDKFLIQSVIVVPDGTTSKYISAELFNNGDGKVVEEFKMRVVYIFANPLLPIPEGFEE*
BLAST of MELO3C022883T1 vs. Swiss-Prot
Match: VAP13_ARATH (Vesicle-associated protein 1-3 OS=Arabidopsis thaliana GN=PVA13 PE=2 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 6.6e-20 Identity = 48/71 (67.61%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of MELO3C022883T1 vs. Swiss-Prot
Match: VAP11_ARATH (Vesicle-associated protein 1-1 OS=Arabidopsis thaliana GN=PVA11 PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.3e-11 Identity = 37/72 (51.39%), Postives = 44/72 (61.11%), Query Frame = 1
BLAST of MELO3C022883T1 vs. Swiss-Prot
Match: VAP31_ARATH (Vesicle-associated protein 3-1 OS=Arabidopsis thaliana GN=PVA31 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.2e-08 Identity = 30/57 (52.63%), Postives = 38/57 (66.67%), Query Frame = 1
BLAST of MELO3C022883T1 vs. Swiss-Prot
Match: VAP22_ARATH (Vesicle-associated protein 2-2 OS=Arabidopsis thaliana GN=PVA22 PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.4e-07 Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 1
BLAST of MELO3C022883T1 vs. Swiss-Prot
Match: VAP21_ARATH (Vesicle-associated protein 2-1 OS=Arabidopsis thaliana GN=PVA21 PE=1 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.2e-06 Identity = 26/57 (45.61%), Postives = 32/57 (56.14%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TrEMBL
Match: A0A0A0KDW5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G109670 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.2e-23 Identity = 59/71 (83.10%), Postives = 61/71 (85.92%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TrEMBL
Match: V4LD23_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10028931mg PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-17 Identity = 48/71 (67.61%), Postives = 57/71 (80.28%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TrEMBL
Match: V4L203_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10028931mg PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-17 Identity = 48/71 (67.61%), Postives = 57/71 (80.28%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TrEMBL
Match: A0A061DU81_THECC (Plant VAMP (Vesicle-associated membrane protein) family protein isoform 1 OS=Theobroma cacao GN=TCM_005557 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-17 Identity = 46/71 (64.79%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TrEMBL
Match: A0A0D3B966_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.6e-17 Identity = 48/71 (67.61%), Postives = 56/71 (78.87%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TAIR10
Match: AT4G00170.1 (AT4G00170.1 Plant VAMP (vesicle-associated membrane protein) family protein) HSP 1 Score: 97.4 bits (241), Expect = 3.7e-21 Identity = 48/71 (67.61%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TAIR10
Match: AT3G60600.1 (AT3G60600.1 vesicle associated protein) HSP 1 Score: 68.2 bits (165), Expect = 2.4e-12 Identity = 37/72 (51.39%), Postives = 44/72 (61.11%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TAIR10
Match: AT2G23830.1 (AT2G23830.1 PapD-like superfamily protein) HSP 1 Score: 60.1 bits (144), Expect = 6.6e-10 Identity = 30/57 (52.63%), Postives = 38/57 (66.67%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TAIR10
Match: AT1G08820.1 (AT1G08820.1 vamp/synaptobrevin-associated protein 27-2) HSP 1 Score: 54.3 bits (129), Expect = 3.6e-08 Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 1
BLAST of MELO3C022883T1 vs. TAIR10
Match: AT5G47180.1 (AT5G47180.1 Plant VAMP (vesicle-associated membrane protein) family protein) HSP 1 Score: 50.4 bits (119), Expect = 5.2e-07 Identity = 26/57 (45.61%), Postives = 32/57 (56.14%), Query Frame = 1
BLAST of MELO3C022883T1 vs. NCBI nr
Match: gi|449445449|ref|XP_004140485.1| (PREDICTED: vesicle-associated protein 1-3 [Cucumis sativus]) HSP 1 Score: 116.7 bits (291), Expect = 1.7e-23 Identity = 59/71 (83.10%), Postives = 61/71 (85.92%), Query Frame = 1
BLAST of MELO3C022883T1 vs. NCBI nr
Match: gi|659116566|ref|XP_008458137.1| (PREDICTED: vesicle-associated protein 1-3 [Cucumis melo]) HSP 1 Score: 116.7 bits (291), Expect = 1.7e-23 Identity = 59/71 (83.10%), Postives = 61/71 (85.92%), Query Frame = 1
BLAST of MELO3C022883T1 vs. NCBI nr
Match: gi|729353910|ref|XP_010544369.1| (PREDICTED: vesicle-associated protein 1-3 isoform X2 [Tarenaya hassleriana]) HSP 1 Score: 99.0 bits (245), Expect = 3.6e-18 Identity = 50/71 (70.42%), Postives = 56/71 (78.87%), Query Frame = 1
BLAST of MELO3C022883T1 vs. NCBI nr
Match: gi|729353907|ref|XP_010544367.1| (PREDICTED: vesicle-associated protein 1-3 isoform X1 [Tarenaya hassleriana]) HSP 1 Score: 99.0 bits (245), Expect = 3.6e-18 Identity = 50/71 (70.42%), Postives = 56/71 (78.87%), Query Frame = 1
BLAST of MELO3C022883T1 vs. NCBI nr
Match: gi|729449454|ref|XP_010523076.1| (PREDICTED: vesicle-associated protein 1-3-like [Tarenaya hassleriana]) HSP 1 Score: 98.2 bits (243), Expect = 6.2e-18 Identity = 49/71 (69.01%), Postives = 56/71 (78.87%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|