MELO3C014693.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAATGGATGGTTAACGATGGCTCTGATCGGTGGTTTTGCTAGAATAGGCAATAATGAAGTCACTATTTTAGTAAATGATGCGGAGAAGGCTAGTGACATTGATCCACAAGAAGCTCAGCAAACTCTCGAAATAGCGGAAGCCAACTTGAGGAAAGCTCAGGACAAGAGACAAACAATCGAGGCAAATTTAGCTCTCAGATGA ATGATGAATGGATGGTTAACGATGGCTCTGATCGGTGGTTTTGCTAGAATAGGCAATAATGAAGTCACTATTTTAGTAAATGATGCGGAGAAGGCTAGTGACATTGATCCACAAGAAGCTCAGCAAACTCTCGAAATAGCGGAAGCCAACTTGAGGAAAGCTCAGGACAAGAGACAAACAATCGAGGCAAATTTAGCTCTCAGATGA ATGATGAATGGATGGTTAACGATGGCTCTGATCGGTGGTTTTGCTAGAATAGGCAATAATGAAGTCACTATTTTAGTAAATGATGCGGAGAAGGCTAGTGACATTGATCCACAAGAAGCTCAGCAAACTCTCGAAATAGCGGAAGCCAACTTGAGGAAAGCTCAGGACAAGAGACAAACAATCGAGGCAAATTTAGCTCTCAGATGA MMNGWLTMALIGGFARIGNNEVTILVNDAEKASDIDPQEAQQTLEIAEANLRKAQDKRQTIEANLALR
BLAST of MELO3C014693.2.1 vs. NCBI nr
Match: YP_009447456.1 (ATP synthase CF1 epsilon subunit (chloroplast) [Cucurbita maxima] >ALO22035.1 AtpE (plastid) [Cucurbita ecuadorensis] >ALO22306.1 AtpE (plastid) [Cucurbita maxima subsp. andreana] >ATY69874.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucurbita maxima]) HSP 1 Score: 120.2 bits (300), Expect = 2.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. NCBI nr
Match: ALO22128.1 (AtpE (plastid) [Cucurbita ficifolia]) HSP 1 Score: 120.2 bits (300), Expect = 2.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. NCBI nr
Match: ALO22914.1 (AtpE (plastid) [Cucurbita pedatifolia]) HSP 1 Score: 120.2 bits (300), Expect = 2.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. NCBI nr
Match: ASY96329.1 (ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo subsp. agrestis]) HSP 1 Score: 120.2 bits (300), Expect = 2.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. NCBI nr
Match: YP_247605.1 (ATP synthase CF1 epsilon subunit [Cucumis sativus] >YP_004841789.1 ATP synthase CF1 epsilon subunit [Cucumis melo subsp. melo] >YP_009004050.1 ATP synthase CF1 epsilon subunit [Cucumis hystrix] >YP_009317392.1 ATP synthase CF1 epsilon subunit (chloroplast) [Coccinia grandis] >YP_009325995.1 ATP synthase CF1 epsilon subunit (chloroplast) [Citrullus lanatus] >YP_009348037.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus mucosospermus] >YP_009420800.1 ATP synthase CF1 epsilon subunit (chloroplast) [Citrullus colocynthis] >YP_009431563.1 ATP synthase CF1 epsilon subunit (chloroplast) [Citrullus amarus] >YP_009431648.1 ATP synthase CF1 epsilon subunit (chloroplast) [Citrullus rehmii] >YP_009456152.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >Q4VZG9.1 RecName: Full=ATP synthase epsilon chain, chloroplastic; AltName: Full=ATP synthase F1 sector epsilon subunit; AltName: Full=F-ATPase epsilon subunit >CAJ00764.1 ATP synthase CF1 epsilon chain (chloroplast) [Cucumis sativus] >AAZ94657.1 ATPase epsilon subunit (chloroplast) [Cucumis sativus] >ABI97423.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis sativus] >ABI98751.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis sativus] >AEM76898.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo subsp. melo] >AEW67086.1 ATP synthase epsilon subunit (chloroplast) [Citrullus lanatus] >AHJ61392.1 ATP synthase CF1 epsilon subunit (plastid) [Cucumis hystrix] >AHM88711.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM88770.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM88828.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM88885.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM88943.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89001.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89060.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89119.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89178.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89237.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89296.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89356.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89415.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89474.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89533.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89593.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89652.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89711.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89770.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89829.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89888.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM89947.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90006.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90065.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90124.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90183.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90242.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90301.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90360.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90419.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90478.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90537.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90596.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90655.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90714.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90773.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90832.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90891.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM90950.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM91009.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM91068.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM91126.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM91186.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM91244.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AHM91301.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >ALF03307.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis sativus var. hardwickii] >ANF28383.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis sativus var. hardwickii] >AOX48761.1 ATP synthase CF1 epsilon subunit (chloroplast) [Coccinia grandis] >AOX48846.1 ATP synthase CF1 epsilon subunit (chloroplast) [Coccinia grandis] >APD52486.1 ATP synthase CF1 epsilon subunit (chloroplast) [Citrullus lanatus] >APW82467.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82552.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82637.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82722.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus mucosospermus] >APW82807.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus mucosospermus] >APW82892.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW82977.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83062.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83147.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83232.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus lanatus subsp. vulgaris] >APW83317.1 ATP synthase CF1 epsilon subunit (plastid) [Citrullus mucosospermus] >ARQ16084.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis sativus] >ARQ16167.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis sativus] >ARQ16250.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis sativus] >ARQ16333.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis sativus] >ASP44463.1 ATP synthase CF1 epsilon subunit (chloroplast) [Citrullus colocynthis] >ASY96160.1 ATP synthase CF1 epsilon subunit (chloroplast) [Citrullus amarus] >ASY96245.1 ATP synthase CF1 epsilon subunit (chloroplast) [Citrullus rehmii] >ASY96416.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo subsp. agrestis] >ASY96503.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo subsp. agrestis] >ASY96590.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. conomon] >ASY96677.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. makuwa] >ASY96764.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. momordica] >ASY96851.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. dudaim] >ASY96938.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. cantalupo] >ASY97025.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. cantalupo] >ASY97112.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. inodorus] >ASY97199.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. cantalupo] >ASY97286.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. flexuosus] >ASY97373.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis melo var. flexuosus] >ASY97459.1 ATP synthase CF1 epsilon subunit (chloroplast) [Cucumis sativus var. hardwickii] >AUJ21918.1 ATP synthase CF1 epsilon subunit (chloroplast) [Lagenaria siceraria] >AVE15337.1 AtpE (chloroplast) [Cucumis sativus var. sativus]) HSP 1 Score: 120.2 bits (300), Expect = 2.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. TAIR10
Match: ATCG00470.1 (ATP synthase epsilon chain) HSP 1 Score: 115.5 bits (288), Expect = 1.2e-26 Identity = 60/68 (88.24%), Postives = 64/68 (94.12%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. Swiss-Prot
Match: sp|Q4VZG9|ATPE_CUCSA (ATP synthase epsilon chain, chloroplastic OS=Cucumis sativus OX=3659 GN=atpE PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 9.1e-27 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. Swiss-Prot
Match: sp|P09468|ATPE_ARATH (ATP synthase epsilon chain, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpE PE=1 SV=2) HSP 1 Score: 115.5 bits (288), Expect = 2.2e-25 Identity = 60/68 (88.24%), Postives = 64/68 (94.12%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. Swiss-Prot
Match: sp|Q09MH2|ATPE_CITSI (ATP synthase epsilon chain, chloroplastic OS=Citrus sinensis OX=2711 GN=atpE PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 2.9e-25 Identity = 59/64 (92.19%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. Swiss-Prot
Match: sp|Q49KZ2|ATPE_EUCGG (ATP synthase epsilon chain, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=atpE PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 1.9e-24 Identity = 57/64 (89.06%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. Swiss-Prot
Match: sp|A0ZZ41|ATPE_GOSBA (ATP synthase epsilon chain, chloroplastic OS=Gossypium barbadense OX=3634 GN=atpE PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 1.9e-24 Identity = 58/64 (90.62%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. TrEMBL
Match: tr|X2EZM8|X2EZM8_LAGSI (ATP synthase epsilon chain, chloroplastic OS=Lagenaria siceraria OX=3668 GN=atpE PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. TrEMBL
Match: tr|A0A249RXP3|A0A249RXP3_CUCME (ATP synthase epsilon chain, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=atpE PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. TrEMBL
Match: tr|A0A286NFP7|A0A286NFP7_CUCME (ATP synthase epsilon chain, chloroplastic OS=Cucumis melo var. flexuosus OX=1120798 GN=atpE PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. TrEMBL
Match: tr|A0A1P8LDH2|A0A1P8LDH2_CITLA (ATP synthase CF1 epsilon subunit OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=atpE PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of MELO3C014693.2.1 vs. TrEMBL
Match: tr|A0A218KG49|A0A218KG49_CUCSA (ATP synthase epsilon chain, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=atpE PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.8e-24 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|