MELO3C011702T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GTTGCGGAGGATGGATATGAATTATTTTCCGAGAGACAACTTGTCACAATATTTTCGACCCCTAACAACTGTGGTGAATTTGATAATGTCGGTGCACTGATGAGTGTTGATGAAGAATTGATGTGCTCTCTCCAGATTCTTAAGCCAGTTGACGAAAATGGTAATAAAGTCATGGTGCCAACAAGAACGTAA GTTGCGGAGGATGGATATGAATTATTTTCCGAGAGACAACTTGTCACAATATTTTCGACCCCTAACAACTGTGGTGAATTTGATAATGTCGGTGCACTGATGAGTGTTGATGAAGAATTGATGTGCTCTCTCCAGATTCTTAAGCCAGTTGACGAAAATGGTAATAAAGTCATGGTGCCAACAAGAACGTAA GTTGCGGAGGATGGATATGAATTATTTTCCGAGAGACAACTTGTCACAATATTTTCGACCCCTAACAACTGTGGTGAATTTGATAATGTCGGTGCACTGATGAGTGTTGATGAAGAATTGATGTGCTCTCTCCAGATTCTTAAGCCAGTTGACGAAAATGGTAATAAAGTCATGGTGCCAACAAGAACGTAA VAEDGYELFSERQLVTIFSTPNNCGEFDNVGALMSVDEELMCSLQILKPVDENGNKVMVPTRT*
BLAST of MELO3C011702T1 vs. Swiss-Prot
Match: PP1A_RABIT (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 7.2e-18 Identity = 41/56 (73.21%), Postives = 44/56 (78.57%), Query Frame = 1
BLAST of MELO3C011702T1 vs. Swiss-Prot
Match: PP1A_RAT (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 7.2e-18 Identity = 41/56 (73.21%), Postives = 44/56 (78.57%), Query Frame = 1
BLAST of MELO3C011702T1 vs. Swiss-Prot
Match: PP1A_BOVIN (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 7.2e-18 Identity = 41/56 (73.21%), Postives = 44/56 (78.57%), Query Frame = 1
BLAST of MELO3C011702T1 vs. Swiss-Prot
Match: PP1A_CANLF (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Canis lupus familiaris GN=PPP1CA PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 7.2e-18 Identity = 41/56 (73.21%), Postives = 44/56 (78.57%), Query Frame = 1
BLAST of MELO3C011702T1 vs. Swiss-Prot
Match: PP1A_MOUSE (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus GN=Ppp1ca PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 7.2e-18 Identity = 41/56 (73.21%), Postives = 44/56 (78.57%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TrEMBL
Match: A0A0A0KQB9_CUCSA (Serine/threonine-protein phosphatase OS=Cucumis sativus GN=Csa_5G184820 PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 7.5e-22 Identity = 52/63 (82.54%), Postives = 54/63 (85.71%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TrEMBL
Match: A0A078FC63_BRANA (Serine/threonine-protein phosphatase OS=Brassica napus GN=BnaC03g70370D PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.2e-17 Identity = 41/62 (66.13%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TrEMBL
Match: A0A078G1S9_BRANA (Serine/threonine-protein phosphatase OS=Brassica napus GN=BnaC04g05540D PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.2e-17 Identity = 41/62 (66.13%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TrEMBL
Match: A0A0D3BQF6_BRAOL (Serine/threonine-protein phosphatase OS=Brassica oleracea var. oleracea PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.2e-17 Identity = 41/62 (66.13%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TrEMBL
Match: A0A022R4S4_ERYGU (Serine/threonine-protein phosphatase (Fragment) OS=Erythranthe guttata GN=MIMGU_mgv1a0105852mg PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 7.2e-17 Identity = 47/62 (75.81%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TAIR10
Match: AT3G46820.1 (AT3G46820.1 type one serine/threonine protein phosphatase 5) HSP 1 Score: 89.4 bits (220), Expect = 9.0e-19 Identity = 41/51 (80.39%), Postives = 43/51 (84.31%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TAIR10
Match: AT5G59160.1 (AT5G59160.1 type one serine/threonine protein phosphatase 2) HSP 1 Score: 88.2 bits (217), Expect = 2.0e-18 Identity = 40/51 (78.43%), Postives = 41/51 (80.39%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TAIR10
Match: AT2G39840.1 (AT2G39840.1 type one serine/threonine protein phosphatase 4) HSP 1 Score: 88.2 bits (217), Expect = 2.0e-18 Identity = 42/62 (67.74%), Postives = 46/62 (74.19%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TAIR10
Match: AT2G29400.1 (AT2G29400.1 type one protein phosphatase 1) HSP 1 Score: 86.7 bits (213), Expect = 5.8e-18 Identity = 38/52 (73.08%), Postives = 42/52 (80.77%), Query Frame = 1
BLAST of MELO3C011702T1 vs. TAIR10
Match: AT1G64040.1 (AT1G64040.1 type one serine/threonine protein phosphatase 3) HSP 1 Score: 83.6 bits (205), Expect = 4.9e-17 Identity = 38/55 (69.09%), Postives = 41/55 (74.55%), Query Frame = 1
BLAST of MELO3C011702T1 vs. NCBI nr
Match: gi|449465842|ref|XP_004150636.1| (PREDICTED: serine/threonine-protein phosphatase PP1 isozyme 4 [Cucumis sativus]) HSP 1 Score: 110.5 bits (275), Expect = 1.1e-21 Identity = 52/63 (82.54%), Postives = 54/63 (85.71%), Query Frame = 1
BLAST of MELO3C011702T1 vs. NCBI nr
Match: gi|659123528|ref|XP_008461712.1| (PREDICTED: serine/threonine-protein phosphatase PP1 isozyme 4 [Cucumis melo]) HSP 1 Score: 110.5 bits (275), Expect = 1.1e-21 Identity = 52/63 (82.54%), Postives = 54/63 (85.71%), Query Frame = 1
BLAST of MELO3C011702T1 vs. NCBI nr
Match: gi|922459683|ref|XP_013631331.1| (PREDICTED: serine/threonine-protein phosphatase PP1 isozyme 4-like [Brassica oleracea var. oleracea]) HSP 1 Score: 94.7 bits (234), Expect = 6.1e-17 Identity = 41/62 (66.13%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of MELO3C011702T1 vs. NCBI nr
Match: gi|923622840|ref|XP_013748031.1| (PREDICTED: serine/threonine-protein phosphatase PP1 isozyme 4-like [Brassica napus]) HSP 1 Score: 94.7 bits (234), Expect = 6.1e-17 Identity = 41/62 (66.13%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of MELO3C011702T1 vs. NCBI nr
Match: gi|674922708|emb|CDY10577.1| (BnaC03g70370D [Brassica napus]) HSP 1 Score: 94.7 bits (234), Expect = 6.1e-17 Identity = 41/62 (66.13%), Postives = 50/62 (80.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|