MELO3C011327T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAACAGGCATTAAAACTGAATGAGATGAGAAGAAAAAAGGGATTGGGAGGTGGTTTTCGGGTGGTGGTGGTGGTGGTTATTTTCCTTAACATATTATTGACGGCAGTGGCGAAGGTGACGGAGCCGCTGGAGGAGAAAGAGGCGGCAGCAGCGGCGGCTGTGAAAGTGAAGGTGGGTGTGGTTTTGGATTTGAATGTTATTGTTGGGAAAATGAGTTTGAGTTGCATTTCAATGGCTCTTGCTGATTTCTATGCTTCTCGGAGTTATTACAAGACCAGAATCATCCTTAATCCCATTGATTCCAATGGCTCTGTTATTCGTGCAGCTGCTGCAGGTTCCATCTTAGCTTATTAA ATGCAACAGGCATTAAAACTGAATGAGATGAGAAGAAAAAAGGGATTGGGAGGTGGTTTTCGGGTGGTGGTGGTGGTGGTTATTTTCCTTAACATATTATTGACGGCAGTGGCGAAGGTGACGGAGCCGCTGGAGGAGAAAGAGGCGGCAGCAGCGGCGGCTGTGAAAGTGAAGGTGGGTGTGGTTTTGGATTTGAATGTTATTGTTGGGAAAATGAGTTTGAGTTGCATTTCAATGGCTCTTGCTGATTTCTATGCTTCTCGGAGTTATTACAAGACCAGAATCATCCTTAATCCCATTGATTCCAATGGCTCTGTTATTCGTGCAGCTGCTGCAGGTTCCATCTTAGCTTATTAA ATGCAACAGGCATTAAAACTGAATGAGATGAGAAGAAAAAAGGGATTGGGAGGTGGTTTTCGGGTGGTGGTGGTGGTGGTTATTTTCCTTAACATATTATTGACGGCAGTGGCGAAGGTGACGGAGCCGCTGGAGGAGAAAGAGGCGGCAGCAGCGGCGGCTGTGAAAGTGAAGGTGGGTGTGGTTTTGGATTTGAATGTTATTGTTGGGAAAATGAGTTTGAGTTGCATTTCAATGGCTCTTGCTGATTTCTATGCTTCTCGGAGTTATTACAAGACCAGAATCATCCTTAATCCCATTGATTCCAATGGCTCTGTTATTCGTGCAGCTGCTGCAGGTTCCATCTTAGCTTATTAA MQQALKLNEMRRKKGLGGGFRVVVVVVIFLNILLTAVAKVTEPLEEKEAAAAAAVKVKVGVVLDLNVIVGKMSLSCISMALADFYASRSYYKTRIILNPIDSNGSVIRAAAAGSILAY*
BLAST of MELO3C011327T1 vs. Swiss-Prot
Match: GLR25_ARATH (Glutamate receptor 2.5 OS=Arabidopsis thaliana GN=GLR2.5 PE=2 SV=2) HSP 1 Score: 58.9 bits (141), Expect = 4.3e-08 Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 1
BLAST of MELO3C011327T1 vs. Swiss-Prot
Match: GLR26_ARATH (Glutamate receptor 2.6 OS=Arabidopsis thaliana GN=GLR2.6 PE=2 SV=2) HSP 1 Score: 55.5 bits (132), Expect = 4.8e-07 Identity = 27/62 (43.55%), Postives = 42/62 (67.74%), Query Frame = 1
BLAST of MELO3C011327T1 vs. Swiss-Prot
Match: GLR21_ARATH (Glutamate receptor 2.1 OS=Arabidopsis thaliana GN=GLR2.1 PE=2 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 1.4e-06 Identity = 29/82 (35.37%), Postives = 44/82 (53.66%), Query Frame = 1
BLAST of MELO3C011327T1 vs. Swiss-Prot
Match: GLR22_ARATH (Glutamate receptor 2.2 OS=Arabidopsis thaliana GN=GLR2.2 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.4e-06 Identity = 26/69 (37.68%), Postives = 39/69 (56.52%), Query Frame = 1
BLAST of MELO3C011327T1 vs. Swiss-Prot
Match: GLR28_ARATH (Glutamate receptor 2.8 OS=Arabidopsis thaliana GN=GLR2.8 PE=2 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 1.4e-06 Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TrEMBL
Match: A0A0A0LSQ2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G383920 PE=4 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 1.3e-40 Identity = 96/105 (91.43%), Postives = 99/105 (94.29%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TrEMBL
Match: A0A0A0LPV9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G383900 PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.7e-24 Identity = 67/104 (64.42%), Postives = 79/104 (75.96%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TrEMBL
Match: A0A0A0LSQ1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G383380 PE=4 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 3.6e-22 Identity = 64/106 (60.38%), Postives = 78/106 (73.58%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TrEMBL
Match: A0A0A0LMA6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G383370 PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.2e-18 Identity = 57/103 (55.34%), Postives = 76/103 (73.79%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TrEMBL
Match: A0A0A0KCD3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G308940 PE=4 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 2.3e-16 Identity = 50/89 (56.18%), Postives = 65/89 (73.03%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TAIR10
Match: AT5G11180.1 (AT5G11180.1 glutamate receptor 2.6) HSP 1 Score: 55.5 bits (132), Expect = 2.7e-08 Identity = 27/62 (43.55%), Postives = 42/62 (67.74%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TAIR10
Match: AT2G29110.1 (AT2G29110.1 glutamate receptor 2.8) HSP 1 Score: 53.9 bits (128), Expect = 7.8e-08 Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TAIR10
Match: AT2G29100.1 (AT2G29100.1 glutamate receptor 2.9) HSP 1 Score: 53.9 bits (128), Expect = 7.8e-08 Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TAIR10
Match: AT2G24720.1 (AT2G24720.1 glutamate receptor 2.2) HSP 1 Score: 53.9 bits (128), Expect = 7.8e-08 Identity = 26/69 (37.68%), Postives = 39/69 (56.52%), Query Frame = 1
BLAST of MELO3C011327T1 vs. TAIR10
Match: AT5G27100.1 (AT5G27100.1 glutamate receptor 2.1) HSP 1 Score: 53.9 bits (128), Expect = 7.8e-08 Identity = 29/82 (35.37%), Postives = 44/82 (53.66%), Query Frame = 1
BLAST of MELO3C011327T1 vs. NCBI nr
Match: gi|659089047|ref|XP_008445300.1| (PREDICTED: glutamate receptor 2.1-like isoform X1 [Cucumis melo]) HSP 1 Score: 193.4 bits (490), Expect = 2.3e-46 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of MELO3C011327T1 vs. NCBI nr
Match: gi|659089049|ref|XP_008445301.1| (PREDICTED: glutamate receptor 2.8-like isoform X2 [Cucumis melo]) HSP 1 Score: 193.4 bits (490), Expect = 2.3e-46 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of MELO3C011327T1 vs. NCBI nr
Match: gi|778674401|ref|XP_004138837.2| (PREDICTED: glutamate receptor 2.5-like [Cucumis sativus]) HSP 1 Score: 173.7 bits (439), Expect = 1.9e-40 Identity = 96/105 (91.43%), Postives = 99/105 (94.29%), Query Frame = 1
BLAST of MELO3C011327T1 vs. NCBI nr
Match: gi|700207902|gb|KGN63021.1| (hypothetical protein Csa_2G383920 [Cucumis sativus]) HSP 1 Score: 173.7 bits (439), Expect = 1.9e-40 Identity = 96/105 (91.43%), Postives = 99/105 (94.29%), Query Frame = 1
BLAST of MELO3C011327T1 vs. NCBI nr
Match: gi|778674398|ref|XP_011650202.1| (PREDICTED: glutamate receptor 2.5-like [Cucumis sativus]) HSP 1 Score: 120.2 bits (300), Expect = 2.5e-24 Identity = 67/104 (64.42%), Postives = 79/104 (75.96%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|