MELO3C009013.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAACACTGATGTATATAGGAGGATTATGTCTACTTGCATCCTTTGGCAGCTTGTTAGAAATATCATAGGGAAGTTTGTAGATGAGACGAAAGCTCAAATGCTGAAAGATAAATGCTTACCATTAGAAGGATGTGTTGTGGTTGCTGGGCGCACTGACAAAGGGGTGACTGCTCTACAACAAGTTTGCACAATTTGTTGTATGTTAGCTTTCTAA ATGGAAAACACTGATGTATATAGGAGGATTATGTCTACTTGCATCCTTTGGCAGCTTGTTAGAAATATCATAGGGAAGTTTGTAGATGAGACGAAAGCTCAAATGCTGAAAGATAAATGCTTACCATTAGAAGGATGTGTTGTGGTTGCTGGGCGCACTGACAAAGGGGTGACTGCTCTACAACAAGTTTGCACAATTTGTTGTATGTTAGCTTTCTAA ATGGAAAACACTGATGTATATAGGAGGATTATGTCTACTTGCATCCTTTGGCAGCTTGTTAGAAATATCATAGGGAAGTTTGTAGATGAGACGAAAGCTCAAATGCTGAAAGATAAATGCTTACCATTAGAAGGATGTGTTGTGGTTGCTGGGCGCACTGACAAAGGGGTGACTGCTCTACAACAAGTTTGCACAATTTGTTGTATGTTAGCTTTCTAA MENTDVYRRIMSTCILWQLVRNIIGKFVDETKAQMLKDKCLPLEGCVVVAGRTDKGVTALQQVCTICCMLAF
BLAST of MELO3C009013.2.1 vs. NCBI nr
Match: XP_008453520.1 (PREDICTED: tRNA pseudouridine synthase A [Cucumis melo]) HSP 1 Score: 83.6 bits (205), Expect = 3.1e-13 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. NCBI nr
Match: XP_015881667.1 (uncharacterized protein LOC107417573 [Ziziphus jujuba]) HSP 1 Score: 83.6 bits (205), Expect = 3.1e-13 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. NCBI nr
Match: XP_015881730.1 (uncharacterized protein LOC107417627 [Ziziphus jujuba]) HSP 1 Score: 83.6 bits (205), Expect = 3.1e-13 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. NCBI nr
Match: XP_004137363.1 (PREDICTED: uncharacterized protein LOC101205562 [Cucumis sativus] >KGN63901.1 hypothetical protein Csa_1G025830 [Cucumis sativus]) HSP 1 Score: 82.4 bits (202), Expect = 6.8e-13 Identity = 38/47 (80.85%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. NCBI nr
Match: XP_022135240.1 (uncharacterized protein LOC111007251 isoform X2 [Momordica charantia]) HSP 1 Score: 81.3 bits (199), Expect = 1.5e-12 Identity = 37/47 (78.72%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. TAIR10
Match: AT5G35400.2 (Pseudouridine synthase family protein) HSP 1 Score: 67.4 bits (163), Expect = 4.1e-12 Identity = 32/47 (68.09%), Postives = 38/47 (80.85%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. TrEMBL
Match: tr|A0A1S3BWI6|A0A1S3BWI6_CUCME (tRNA pseudouridine synthase OS=Cucumis melo OX=3656 GN=LOC103494203 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 2.0e-13 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. TrEMBL
Match: tr|A0A0A0LV59|A0A0A0LV59_CUCSA (tRNA pseudouridine synthase OS=Cucumis sativus OX=3659 GN=Csa_1G025830 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 4.5e-13 Identity = 38/47 (80.85%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. TrEMBL
Match: tr|W9S3H9|W9S3H9_9ROSA (tRNA pseudouridine synthase OS=Morus notabilis OX=981085 GN=L484_008208 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.7e-12 Identity = 37/47 (78.72%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. TrEMBL
Match: tr|A0A2G2Z1Z0|A0A2G2Z1Z0_CAPAN (Uncharacterized protein OS=Capsicum annuum OX=4072 GN=T459_19530 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 35/49 (71.43%), Postives = 41/49 (83.67%), Query Frame = 0
BLAST of MELO3C009013.2.1 vs. TrEMBL
Match: tr|A0A2G2WCH7|A0A2G2WCH7_CAPBA (Uncharacterized protein OS=Capsicum baccatum OX=33114 GN=CQW23_16927 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 35/49 (71.43%), Postives = 41/49 (83.67%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|