MELO3C004918.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACTCTGTCCCTGCCGAGCCTTCTAAGTGGCTTCATCCTCCATTCTCCGCTGTCCGAACCTCCGATGGTAAAATCTTCGCCCGTGGTTCTCAAGATGACAAGTCTATCGCCATCCAGTGTCTTGAAGCCATTCGAAATCTCAGAAACCAGGATTTCATCCCTGTCCGTACGATTCATATATCGTATGTATCAAATGAGGAGATTAAGGGTTCCGATGGAGTTGCAAAGTTCGTTTAG ATGGACTCTGTCCCTGCCGAGCCTTCTAAGTGGCTTCATCCTCCATTCTCCGCTGTCCGAACCTCCGATGGTAAAATCTTCGCCCGTGGTTCTCAAGATGACAAGTCTATCGCCATCCAGTGTCTTGAAGCCATTCGAAATCTCAGAAACCAGGATTTCATCCCTGTCCGTACGATTCATATATCGTATGTATCAAATGAGGAGATTAAGGGTTCCGATGGAGTTGCAAAGTTCGTTTAG ATGGACTCTGTCCCTGCCGAGCCTTCTAAGTGGCTTCATCCTCCATTCTCCGCTGTCCGAACCTCCGATGGTAAAATCTTCGCCCGTGGTTCTCAAGATGACAAGTCTATCGCCATCCAGTGTCTTGAAGCCATTCGAAATCTCAGAAACCAGGATTTCATCCCTGTCCGTACGATTCATATATCGTATGTATCAAATGAGGAGATTAAGGGTTCCGATGGAGTTGCAAAGTTCGTTTAG MDSVPAEPSKWLHPPFSAVRTSDGKIFARGSQDDKSIAIQCLEAIRNLRNQDFIPVRTIHISYVSNEEIKGSDGVAKFV
BLAST of MELO3C004918.2.1 vs. NCBI nr
Match: KGN63599.1 (hypothetical protein Csa_1G005600 [Cucumis sativus]) HSP 1 Score: 146.0 bits (367), Expect = 5.5e-32 Identity = 70/79 (88.61%), Postives = 74/79 (93.67%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. NCBI nr
Match: XP_022141532.1 (aminoacylase-1 [Momordica charantia] >XP_022141534.1 aminoacylase-1 [Momordica charantia]) HSP 1 Score: 134.8 bits (338), Expect = 1.3e-28 Identity = 65/79 (82.28%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. NCBI nr
Match: XP_022964785.1 (aminoacylase-1 [Cucurbita moschata]) HSP 1 Score: 134.4 bits (337), Expect = 1.7e-28 Identity = 66/79 (83.54%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. NCBI nr
Match: XP_022991055.1 (aminoacylase-1 [Cucurbita maxima]) HSP 1 Score: 134.0 bits (336), Expect = 2.2e-28 Identity = 65/79 (82.28%), Postives = 72/79 (91.14%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. NCBI nr
Match: XP_023553812.1 (aminoacylase-1 [Cucurbita pepo subsp. pepo] >XP_023553821.1 aminoacylase-1 [Cucurbita pepo subsp. pepo] >XP_023553828.1 aminoacylase-1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 133.3 bits (334), Expect = 3.7e-28 Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. TAIR10
Match: AT1G44180.1 (Peptidase M20/M25/M40 family protein) HSP 1 Score: 112.1 bits (279), Expect = 1.6e-25 Identity = 52/78 (66.67%), Postives = 62/78 (79.49%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. TAIR10
Match: AT1G44820.1 (Peptidase M20/M25/M40 family protein) HSP 1 Score: 108.6 bits (270), Expect = 1.8e-24 Identity = 50/78 (64.10%), Postives = 62/78 (79.49%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. TAIR10
Match: AT4G38220.2 (Peptidase M20/M25/M40 family protein) HSP 1 Score: 80.9 bits (198), Expect = 3.9e-16 Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. Swiss-Prot
Match: sp|Q99JW2|ACY1_MOUSE (Aminoacylase-1 OS=Mus musculus OX=10090 GN=Acy1 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.9e-14 Identity = 37/78 (47.44%), Postives = 52/78 (66.67%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. Swiss-Prot
Match: sp|Q6AYS7|ACY1A_RAT (Aminoacylase-1A OS=Rattus norvegicus OX=10116 GN=Acy1a PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.8e-13 Identity = 36/78 (46.15%), Postives = 52/78 (66.67%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. Swiss-Prot
Match: sp|Q5RFB0|ACY1_PONAB (Aminoacylase-1 OS=Pongo abelii OX=9601 GN=ACY1 PE=2 SV=2) HSP 1 Score: 73.9 bits (180), Expect = 8.7e-13 Identity = 36/78 (46.15%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. Swiss-Prot
Match: sp|Q03154|ACY1_HUMAN (Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-12 Identity = 35/78 (44.87%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. Swiss-Prot
Match: sp|Q6PTT0|ACY1B_RAT (Aminoacylase-1B OS=Rattus norvegicus OX=10116 GN=Acy1b PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 7.4e-12 Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. TrEMBL
Match: tr|A0A0A0LRI1|A0A0A0LRI1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G005600 PE=4 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 3.6e-32 Identity = 70/79 (88.61%), Postives = 74/79 (93.67%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. TrEMBL
Match: tr|A0A2C9WGT2|A0A2C9WGT2_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_02G161800 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 9.3e-28 Identity = 62/79 (78.48%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. TrEMBL
Match: tr|F6H0T0|F6H0T0_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_18s0001g03230 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 7.9e-27 Identity = 62/79 (78.48%), Postives = 67/79 (84.81%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. TrEMBL
Match: tr|A0A059BZ79|A0A059BZ79_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_F04363 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.3e-26 Identity = 57/79 (72.15%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of MELO3C004918.2.1 vs. TrEMBL
Match: tr|A0A2P4L1H1|A0A2P4L1H1_QUESU (Aminoacylase-1 OS=Quercus suber OX=58331 GN=CFP56_50613 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.8e-26 Identity = 58/79 (73.42%), Postives = 69/79 (87.34%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|