Lsi09G010570.1 (mRNA) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACGTAAGTAGTGGTTTTGGAGTTCATAAATACATGGTCGTCTGATCTGAGTATCATTATTTTGGGTTTGAAAGGAAAAGAAAAGATTGAAGATAATGAATGAGAGAGTATTGCAGGATGCTTTGCCCACAATTCTCATGGTTTTAGTTCAGTTTGGGTTTGCTGGAGTTAACATTTGCTACAAATTAGCTGCTGCCGATGGAATGAGTTTGAGGATTATTATTGCTTATCGTTTCTTATTTGCCTCTGCTTTCATTCTTTCCATTGCCTTCTTTCTCAAAAGGTAAATTTGTTTTTCTTTTTTACTTGCAGGTAGTCTAAGTAGTACCTAAGTATTAATTAATTAATTTAATTAAATTATTTGCAGAGGTAGAAGGCCGAAGCTTACTTGGTCGGTTCTTTTCAATGCTTTTCTATCTGGACTCTTTGGGTAA ATGACATTGAAGATAATGAATGAGAGAGTATTGCAGGATGCTTTGCCCACAATTCTCATGGTTTTAGTTCAGTTTGGGTTTGCTGGAGTTAACATTTGCTACAAATTAGCTGCTGCCGATGGAATGAGTTTGAGGATTATTATTGCTTATCGTTTCTTATTTGCCTCTGCTTTCATTCTTTCCATTGCCTTCTTTCTCAAAAGAGGTAGAAGGCCGAAGCTTACTTGGTCGGTTCTTTTCAATGCTTTTCTATCTGGACTCTTTGGGTAA ATGACATTGAAGATAATGAATGAGAGAGTATTGCAGGATGCTTTGCCCACAATTCTCATGGTTTTAGTTCAGTTTGGGTTTGCTGGAGTTAACATTTGCTACAAATTAGCTGCTGCCGATGGAATGAGTTTGAGGATTATTATTGCTTATCGTTTCTTATTTGCCTCTGCTTTCATTCTTTCCATTGCCTTCTTTCTCAAAAGAGGTAGAAGGCCGAAGCTTACTTGGTCGGTTCTTTTCAATGCTTTTCTATCTGGACTCTTTGGGTAA MTLKIMNERVLQDALPTILMVLVQFGFAGVNICYKLAAADGMSLRIIIAYRFLFASAFILSIAFFLKRGRRPKLTWSVLFNAFLSGLFG
BLAST of Lsi09G010570.1 vs. Swiss-Prot
Match: WTR2_ARATH (WAT1-related protein At1g09380 OS=Arabidopsis thaliana GN=At1g09380 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.0e-10 Identity = 35/77 (45.45%), Postives = 48/77 (62.34%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. Swiss-Prot
Match: WTR10_ARATH (WAT1-related protein At1g68170 OS=Arabidopsis thaliana GN=At1g68170 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-10 Identity = 33/70 (47.14%), Postives = 48/70 (68.57%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. Swiss-Prot
Match: WTR38_ARATH (WAT1-related protein At5g07050 OS=Arabidopsis thaliana GN=At5g07050 PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.3e-09 Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. Swiss-Prot
Match: WTR27_ARATH (WAT1-related protein At3g56620 OS=Arabidopsis thaliana GN=At3g56620 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-07 Identity = 31/84 (36.90%), Postives = 48/84 (57.14%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. Swiss-Prot
Match: WTR15_ARATH (WAT1-related protein At2g40900 OS=Arabidopsis thaliana GN=At2g40900 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.6e-07 Identity = 32/84 (38.10%), Postives = 46/84 (54.76%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TrEMBL
Match: A0A0A0LLC4_CUCSA (WAT1-related protein OS=Cucumis sativus GN=Csa_2G151030 PE=3 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 4.6e-30 Identity = 72/84 (85.71%), Postives = 77/84 (91.67%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TrEMBL
Match: G7IL80_MEDTR (WAT1-related protein OS=Medicago truncatula GN=MTR_2g007990 PE=3 SV=2) HSP 1 Score: 105.5 bits (262), Expect = 3.3e-20 Identity = 51/80 (63.75%), Postives = 65/80 (81.25%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TrEMBL
Match: W9RV49_9ROSA (WAT1-related protein OS=Morus notabilis GN=L484_024170 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.4e-18 Identity = 49/74 (66.22%), Postives = 61/74 (82.43%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TrEMBL
Match: M5XJE3_PRUPE (WAT1-related protein OS=Prunus persica GN=PRUPE_ppa023190mg PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.8e-18 Identity = 51/79 (64.56%), Postives = 58/79 (73.42%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TrEMBL
Match: A0A0A0LNI5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G151070 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 5.3e-18 Identity = 49/79 (62.03%), Postives = 60/79 (75.95%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TAIR10
Match: AT1G09380.1 (AT1G09380.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 66.2 bits (160), Expect = 1.1e-11 Identity = 35/77 (45.45%), Postives = 48/77 (62.34%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TAIR10
Match: AT1G68170.1 (AT1G68170.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 65.5 bits (158), Expect = 1.9e-11 Identity = 33/70 (47.14%), Postives = 48/70 (68.57%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TAIR10
Match: AT5G07050.1 (AT5G07050.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 63.5 bits (153), Expect = 7.4e-11 Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TAIR10
Match: AT3G56620.1 (AT3G56620.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 56.6 bits (135), Expect = 9.0e-09 Identity = 31/84 (36.90%), Postives = 48/84 (57.14%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. TAIR10
Match: AT2G40900.1 (AT2G40900.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 55.1 bits (131), Expect = 2.6e-08 Identity = 32/84 (38.10%), Postives = 46/84 (54.76%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. NCBI nr
Match: gi|659114878|ref|XP_008457270.1| (PREDICTED: WAT1-related protein At1g25270-like [Cucumis melo]) HSP 1 Score: 143.3 bits (360), Expect = 2.1e-31 Identity = 73/84 (86.90%), Postives = 78/84 (92.86%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. NCBI nr
Match: gi|778674135|ref|XP_004139017.2| (PREDICTED: WAT1-related protein At1g25270-like [Cucumis sativus]) HSP 1 Score: 139.4 bits (350), Expect = 3.0e-30 Identity = 73/85 (85.88%), Postives = 78/85 (91.76%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. NCBI nr
Match: gi|700206393|gb|KGN61512.1| (hypothetical protein Csa_2G151030 [Cucumis sativus]) HSP 1 Score: 138.3 bits (347), Expect = 6.7e-30 Identity = 72/84 (85.71%), Postives = 77/84 (91.67%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. NCBI nr
Match: gi|657973965|ref|XP_008378803.1| (PREDICTED: WAT1-related protein At1g25270-like [Malus domestica]) HSP 1 Score: 105.9 bits (263), Expect = 3.7e-20 Identity = 52/74 (70.27%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Lsi09G010570.1 vs. NCBI nr
Match: gi|922385634|ref|XP_003593117.2| (auxin-induced 5NG4-like protein [Medicago truncatula]) HSP 1 Score: 105.5 bits (262), Expect = 4.8e-20 Identity = 51/80 (63.75%), Postives = 65/80 (81.25%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
|