Cucsa.255030.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGAATGCAAGGGTAAATATAACTTCATAACTCTCTCTCTCTTCCTCTATTCTGTGTTTCTGTTTAATTTTGGTTTATAAATACTCGTATGGTTTTAACTTGATTCATTTTAGTTTTTATAATTAAAAACATACTTAAGGATTGATAAACGAAATCTAGCTATAATGTTAACCTAGTGGAGTTTTTTTTTCTTGAGATAGAAGTTTTGTGAGATTTAAGTGCAATTTGATATGATGTGTGTTAATAGAGCATTTAATTAAGATTGTGAATTGAGGTGAGGCGTGGCGTTGGGTGAACAGGAAAAAGGTCATGGCCGCAGCTGGTGGGAGTTGGAGGGTCAGTTGCGAAGGCCATCATCGAGAGGGAGAATCCGAACGTAAGAGCGGTGGTCTTAGAGGTGGGAACTCCGGTGACGAAGGACTTTCGATGCAATCGGGTTCGGGTTTGGGTCAAGAAGAACGGACTTGTTGCAAGCCCACCTATGGTTGGCTAA ATGTCTGAATGCAAGGGAAAAAGGTCATGGCCGCAGCTGGTGGGAGTTGGAGGGTCAGTTGCGAAGGCCATCATCGAGAGGGAGAATCCGAACGTAAGAGCGGTGGTCTTAGAGGTGGGAACTCCGGTGACGAAGGACTTTCGATGCAATCGGGTTCGGGTTTGGGTCAAGAAGAACGGACTTGTTGCAAGCCCACCTATGGTTGGCTAA ATGTCTGAATGCAAGGGAAAAAGGTCATGGCCGCAGCTGGTGGGAGTTGGAGGGTCAGTTGCGAAGGCCATCATCGAGAGGGAGAATCCGAACGTAAGAGCGGTGGTCTTAGAGGTGGGAACTCCGGTGACGAAGGACTTTCGATGCAATCGGGTTCGGGTTTGGGTCAAGAAGAACGGACTTGTTGCAAGCCCACCTATGGTTGGCTAA MSECKGKRSWPQLVGVGGSVAKAIIERENPNVRAVVLEVGTPVTKDFRCNRVRVWVKKNGLVASPPMVG*
BLAST of Cucsa.255030.1 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.2e-26 Identity = 54/68 (79.41%), Postives = 59/68 (86.76%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 4.7e-23 Identity = 47/68 (69.12%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 9.0e-14 Identity = 35/65 (53.85%), Postives = 48/65 (73.85%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. Swiss-Prot
Match: HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis GN=PI1 PE=1 SV=2) HSP 1 Score: 75.5 bits (184), Expect = 2.6e-13 Identity = 33/68 (48.53%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. Swiss-Prot
Match: ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 7.6e-13 Identity = 37/66 (56.06%), Postives = 44/66 (66.67%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TrEMBL
Match: Q7M1Q1_MOMCH (Trypsin inhibitor BGIT OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.7e-19 Identity = 45/68 (66.18%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TrEMBL
Match: Q9AYN0_MOMCH (Inhibitor against trypsin (Fragment) OS=Momordica charantia GN=bgit PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 4.9e-19 Identity = 44/66 (66.67%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TrEMBL
Match: A0A0L9TY84_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan02g169300 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.0e-16 Identity = 45/69 (65.22%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TrEMBL
Match: A0A0S3SPN1_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G139300 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.0e-16 Identity = 45/69 (65.22%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TrEMBL
Match: A0A0D2QSL7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G143500 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.3e-16 Identity = 44/69 (63.77%), Postives = 49/69 (71.01%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 77.8 bits (190), Expect = 3.0e-15 Identity = 36/68 (52.94%), Postives = 44/68 (64.71%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TAIR10
Match: AT3G46860.1 (AT3G46860.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 70.5 bits (171), Expect = 4.7e-13 Identity = 34/63 (53.97%), Postives = 42/63 (66.67%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 70.5 bits (171), Expect = 4.7e-13 Identity = 33/67 (49.25%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TAIR10
Match: AT2G38900.2 (AT2G38900.2 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 61.2 bits (147), Expect = 2.9e-10 Identity = 28/64 (43.75%), Postives = 39/64 (60.94%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. TAIR10
Match: AT5G43570.1 (AT5G43570.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 47.0 bits (110), Expect = 5.6e-06 Identity = 25/61 (40.98%), Postives = 32/61 (52.46%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. NCBI nr
Match: gi|659077749|ref|XP_008439364.1| (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. NCBI nr
Match: gi|159162696|pdb|1MIT|A (Chain A, Recombinant Cucurbita Maxima Trypsin Inhibitor V (Rcmti-V) (Nmr, Minimized Average Structure)) HSP 1 Score: 119.8 bits (299), Expect = 1.9e-24 Identity = 54/68 (79.41%), Postives = 59/68 (86.76%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. NCBI nr
Match: gi|124984|sp|P19873.1|ITH5_CUCMA (RecName: Full=Inhibitor of trypsin and hageman factor; AltName: Full=CMTI-V) HSP 1 Score: 119.8 bits (299), Expect = 1.9e-24 Identity = 54/68 (79.41%), Postives = 59/68 (86.76%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. NCBI nr
Match: gi|253723128|pdb|1TIN|A (Chain A, Three-Dimensional Structure In Solution Of Cucurbita Maxima Trypsin Inhibitor-V Determined By Nmr Spectroscopy) HSP 1 Score: 119.8 bits (299), Expect = 1.9e-24 Identity = 54/68 (79.41%), Postives = 59/68 (86.76%), Query Frame = 1
BLAST of Cucsa.255030.1 vs. NCBI nr
Match: gi|114950|sp|P24076.1|BGIA_MOMCH (RecName: Full=Glu S.griseus protease inhibitor; AltName: Full=BGIA) HSP 1 Score: 107.8 bits (268), Expect = 7.6e-21 Identity = 47/68 (69.12%), Postives = 58/68 (85.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|