Cucsa.102860.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAATCTGTTTCCGTCACTTTGGTTCTTCTTTCATTGATTCTGAGCTCATTCTTCCTCCAATATGCCACTGCTGATTCCTCTACAACCTATGCTCCAAGTAAGATAAATGATTTACTATACATATATAAATATTAAATACCATTGGCAATGAATATACAACCTTTCATTCATTCCTCCTTGTTCAAGTGATTAACTGGTTTATTGTTTTGACCTTTTTCCTTCTTTTTGTTTTCTTCTTTTAGAAGGTGTTTGTGATTCAAAATGTGGGGTAAGATGCTTGAATGCAGGGGTGAAGGACAGGTGTTTGAAGTATTGTGGACTCTGCTGCCAACAGTGCAAGTGTGTGCCCTCTGGAACCTATGGAAACAAATCAGAATGCCCTTGTTATAGAGACAAGTTGAACTCCAAGGGAAAATCTAAATGCCCTTGA ATGAAATCTGTTTCCGTCACTTTGGTTCTTCTTTCATTGATTCTGAGCTCATTCTTCCTCCAATATGCCACTGCTGATTCCTCTACAACCTATGCTCCAAAAGGTGTTTGTGATTCAAAATGTGGGGTAAGATGCTTGAATGCAGGGGTGAAGGACAGGTGTTTGAAGTATTGTGGACTCTGCTGCCAACAGTGCAAGTGTGTGCCCTCTGGAACCTATGGAAACAAATCAGAATGCCCTTGTTATAGAGACAAGTTGAACTCCAAGGGAAAATCTAAATGCCCTTGA ATGAAATCTGTTTCCGTCACTTTGGTTCTTCTTTCATTGATTCTGAGCTCATTCTTCCTCCAATATGCCACTGCTGATTCCTCTACAACCTATGCTCCAAAAGGTGTTTGTGATTCAAAATGTGGGGTAAGATGCTTGAATGCAGGGGTGAAGGACAGGTGTTTGAAGTATTGTGGACTCTGCTGCCAACAGTGCAAGTGTGTGCCCTCTGGAACCTATGGAAACAAATCAGAATGCCCTTGTTATAGAGACAAGTTGAACTCCAAGGGAAAATCTAAATGCCCTTGA MKSVSVTLVLLSLILSSFFLQYATADSSTTYAPKGVCDSKCGVRCLNAGVKDRCLKYCGLCCQQCKCVPSGTYGNKSECPCYRDKLNSKGKSKCP*
BLAST of Cucsa.102860.1 vs. Swiss-Prot
Match: SNAK1_SOLTU (Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 3.2e-30 Identity = 58/95 (61.05%), Postives = 71/95 (74.74%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. Swiss-Prot
Match: GASAA_ARATH (Gibberellin-regulated protein 10 OS=Arabidopsis thaliana GN=GASA10 PE=2 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.1e-25 Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. Swiss-Prot
Match: GASA8_ARATH (Gibberellin-regulated protein 8 OS=Arabidopsis thaliana GN=At2g39540 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.8e-25 Identity = 53/95 (55.79%), Postives = 64/95 (67.37%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. Swiss-Prot
Match: PMLN_PRUPE (Peamaclein OS=Prunus persica PE=1 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.1e-25 Identity = 45/59 (76.27%), Postives = 50/59 (84.75%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. Swiss-Prot
Match: GASA7_ARATH (Gibberellin-regulated protein 7 OS=Arabidopsis thaliana GN=GASA7 PE=3 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.5e-24 Identity = 59/108 (54.63%), Postives = 67/108 (62.04%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TrEMBL
Match: A0A0A0KLG3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G493840 PE=4 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 2.0e-50 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TrEMBL
Match: F6HSV8_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_07s0129g00580 PE=4 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 3.1e-32 Identity = 71/120 (59.17%), Postives = 77/120 (64.17%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TrEMBL
Match: A0A0D2TJG1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G220200 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 5.9e-31 Identity = 62/97 (63.92%), Postives = 75/97 (77.32%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TrEMBL
Match: A0A0U2XMH8_9ROSI (Snakin-1 OS=Dimocarpus longan PE=2 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 3.8e-30 Identity = 64/99 (64.65%), Postives = 74/99 (74.75%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TrEMBL
Match: A0A061DIB7_THECC (Gibberellin-regulated family protein, putative OS=Theobroma cacao GN=TCM_000737 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 6.5e-30 Identity = 64/107 (59.81%), Postives = 74/107 (69.16%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TAIR10
Match: AT5G59845.1 (AT5G59845.1 Gibberellin-regulated family protein) HSP 1 Score: 117.1 bits (292), Expect = 6.0e-27 Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TAIR10
Match: AT2G39540.1 (AT2G39540.1 Gibberellin-regulated family protein) HSP 1 Score: 116.3 bits (290), Expect = 1.0e-26 Identity = 53/95 (55.79%), Postives = 64/95 (67.37%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TAIR10
Match: AT2G14900.1 (AT2G14900.1 Gibberellin-regulated family protein) HSP 1 Score: 113.2 bits (282), Expect = 8.7e-26 Identity = 59/108 (54.63%), Postives = 67/108 (62.04%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TAIR10
Match: AT1G10588.1 (AT1G10588.1 Gibberellin-regulated family protein) HSP 1 Score: 105.1 bits (261), Expect = 2.4e-23 Identity = 50/93 (53.76%), Postives = 60/93 (64.52%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. TAIR10
Match: AT3G10185.1 (AT3G10185.1 Gibberellin-regulated family protein) HSP 1 Score: 82.0 bits (201), Expect = 2.2e-16 Identity = 41/93 (44.09%), Postives = 51/93 (54.84%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. NCBI nr
Match: gi|700193372|gb|KGN48576.1| (hypothetical protein Csa_6G493840 [Cucumis sativus]) HSP 1 Score: 206.1 bits (523), Expect = 2.8e-50 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. NCBI nr
Match: gi|659079595|ref|XP_008440339.1| (PREDICTED: peamaclein-like [Cucumis melo]) HSP 1 Score: 193.0 bits (489), Expect = 2.5e-46 Identity = 90/95 (94.74%), Postives = 91/95 (95.79%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. NCBI nr
Match: gi|225438912|ref|XP_002283986.1| (PREDICTED: snakin-1-like [Vitis vinifera]) HSP 1 Score: 145.6 bits (366), Expect = 4.5e-32 Identity = 71/120 (59.17%), Postives = 77/120 (64.17%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. NCBI nr
Match: gi|823192938|ref|XP_012491920.1| (PREDICTED: peamaclein-like [Gossypium raimondii]) HSP 1 Score: 141.4 bits (355), Expect = 8.5e-31 Identity = 62/97 (63.92%), Postives = 75/97 (77.32%), Query Frame = 1
BLAST of Cucsa.102860.1 vs. NCBI nr
Match: gi|961506028|gb|ALS40409.1| (snakin-1 [Dimocarpus longan]) HSP 1 Score: 138.7 bits (348), Expect = 5.5e-30 Identity = 64/99 (64.65%), Postives = 74/99 (74.75%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|