Csa6G430670.2 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TATATTTGAAGTTGTTTGTATTAAGAACAAACATATATATGGTTTTTAATTAGAAGGATGATTTCTCACCTTCGTTTTCCCTTTCTGTTGGAGGTCTCCCACCACCTCCACCTCTCCTCTTTGAGTCCCCATGGCTGCTCGGAAGGAGGTAATTTAATTCTTCTTTTTCCCTCTTCATTCATTTATTTTATTATCATGTAATGATTATCCCATGAGTTTATTTAAATTTTAAATGTTTGAATTCTGGAGTCCAATCTGGGTTCCTTTTTTTCTTTTTATTTCTTATCAAATCTCATTTATGTTAAATAGTATATTTGTAGTAATGTTGTATTGTTATTAAGAAAAAAGAAGCATTTAGAGGATGGTGGTGCTTTAGTTGGTTAATTAAATATGGTGGTTTGGCTTGAAACTATGGGTGTCTTTTTTGTATCCAATAGTTCAAAATTTTAATTACAAGATCTTGAATCTTCTAACATTTTGAGCTAAAAAATTAGAAAGAATTCACTTTGAACGTCCAAAACGATTGCATTTATGAAGGATAATGATTAGGTGCATCTTCGTGCTCCCGATTCTTTACAAGAATAAAGAATAATGTTTTTAGTACTAGTCCAAGTTTTTTTTCCTTTTCTGAAATAGAAATAGGAAAAGTTTTCAGGAAAATTTTTGAATTTCTTATCCTAATTCAAGAGAATCATTGTATTTGATTCTCTTGCATCTGGAACAACTGCTGGCAAAAACAACCATAATGAATAAATAAGAAAGCAATCAAAATCATAAAAATTGGTGATGTGAGGAAGAAAAATATGATGAATCTATTTGAATATGCAACTAAAAGTTTGGTTGGTATATTTGTGTGTTTATGAAGAACAATAGGTGGAGGTCAGTTCCAGAATTTGGGGGTTGGGATCACAATGCGCCAGGAGCAAGCAATTATTCTGTTGTATTTACTCAAGCTCGAGCCGATAGAAAACAACAAAAAACTGATTTAACCGAGTTCAAAAAAACCAGCCTAGGGAATGAAAAGGAGTTAATGGAAGCTGTGGATAAACATCATCGCCACCAAAAACATCGCCATCATCGTCATCGCCATCGCCATCACCACCACCACCACCATGACCATGACCATGACCATGAACACCAACACCATCACCACCAACATCATCATCAATCACCACCAGGAGATGACTCTGTTGGCCCGGTAAGTACTTTCACCCATTCTTTTCTAAGTACAAAATATTGAGAAAATGAGGATTTGAGCCTCCGACCTTTAGAGAACAAGTACTTTTTTCATGTCAATTATTATAATGAGTTAT ATGGCTGCTCGGAAGGAGAACAATAGGTGGAGGTCAGTTCCAGAATTTGGGGGTTGGGATCACAATGCGCCAGGAGCAAGCAATTATTCTGTTGTATTTACTCAAGCTCGAGCCGATAGAAAACAACAAAAAACTGATTTAACCGAGTTCAAAAAAACCAGCCTAGGGAATGAAAAGGAGTTAATGGAAGCTGTGGATAAACATCATCGCCACCAAAAACATCGCCATCATCGTCATCGCCATCGCCATCACCACCACCACCACCATGACCATGACCATGACCATGAACACCAACACCATCACCACCAACATCATCATCAATCACCACCAGGAGATGACTCTGTTGGCCCGGTAAGTACTTTCACCCATTCTTTTCTAAGTACAAAATATTGA ATGGCTGCTCGGAAGGAGAACAATAGGTGGAGGTCAGTTCCAGAATTTGGGGGTTGGGATCACAATGCGCCAGGAGCAAGCAATTATTCTGTTGTATTTACTCAAGCTCGAGCCGATAGAAAACAACAAAAAACTGATTTAACCGAGTTCAAAAAAACCAGCCTAGGGAATGAAAAGGAGTTAATGGAAGCTGTGGATAAACATCATCGCCACCAAAAACATCGCCATCATCGTCATCGCCATCGCCATCACCACCACCACCACCATGACCATGACCATGACCATGAACACCAACACCATCACCACCAACATCATCATCAATCACCACCAGGAGATGACTCTGTTGGCCCGGTAAGTACTTTCACCCATTCTTTTCTAAGTACAAAATATTGA MAARKENNRWRSVPEFGGWDHNAPGASNYSVVFTQARADRKQQKTDLTEFKKTSLGNEKELMEAVDKHHRHQKHRHHRHRHRHHHHHHHDHDHDHEHQHHHHQHHHQSPPGDDSVGPVSTFTHSFLSTKY*
BLAST of Csa6G430670.2 vs. Swiss-Prot
Match: Y7791_DICDI (Uncharacterized histidine-rich protein DDB_G0274557 OS=Dictyostelium discoideum GN=DDB_G0274557 PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.7e-16 Identity = 27/42 (64.29%), Postives = 25/42 (59.52%), Query Frame = 1
HSP 2 Score: 84.7 bits (208), Expect = 8.1e-16 Identity = 27/42 (64.29%), Postives = 25/42 (59.52%), Query Frame = 1
HSP 3 Score: 83.2 bits (204), Expect = 2.3e-15 Identity = 26/39 (66.67%), Postives = 24/39 (61.54%), Query Frame = 1
HSP 4 Score: 79.3 bits (194), Expect = 3.4e-14 Identity = 25/39 (64.10%), Postives = 23/39 (58.97%), Query Frame = 1
HSP 5 Score: 79.0 bits (193), Expect = 4.4e-14 Identity = 25/38 (65.79%), Postives = 23/38 (60.53%), Query Frame = 1
HSP 6 Score: 78.2 bits (191), Expect = 7.5e-14 Identity = 27/46 (58.70%), Postives = 25/46 (54.35%), Query Frame = 1
HSP 7 Score: 77.0 bits (188), Expect = 1.7e-13 Identity = 25/39 (64.10%), Postives = 23/39 (58.97%), Query Frame = 1
HSP 8 Score: 77.0 bits (188), Expect = 1.7e-13 Identity = 26/43 (60.47%), Postives = 24/43 (55.81%), Query Frame = 1
HSP 9 Score: 77.0 bits (188), Expect = 1.7e-13 Identity = 26/40 (65.00%), Postives = 24/40 (60.00%), Query Frame = 1
HSP 10 Score: 76.3 bits (186), Expect = 2.9e-13 Identity = 26/44 (59.09%), Postives = 24/44 (54.55%), Query Frame = 1
HSP 11 Score: 75.9 bits (185), Expect = 3.7e-13 Identity = 26/43 (60.47%), Postives = 24/43 (55.81%), Query Frame = 1
HSP 12 Score: 70.1 bits (170), Expect = 2.1e-11 Identity = 23/43 (53.49%), Postives = 23/43 (53.49%), Query Frame = 1
BLAST of Csa6G430670.2 vs. Swiss-Prot
Match: HRPX_PLALO (Histidine-rich glycoprotein OS=Plasmodium lophurae PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 7.5e-14 Identity = 25/39 (64.10%), Postives = 23/39 (58.97%), Query Frame = 1
HSP 2 Score: 77.8 bits (190), Expect = 9.8e-14 Identity = 25/39 (64.10%), Postives = 23/39 (58.97%), Query Frame = 1
HSP 3 Score: 76.6 bits (187), Expect = 2.2e-13 Identity = 26/44 (59.09%), Postives = 25/44 (56.82%), Query Frame = 1
HSP 4 Score: 76.3 bits (186), Expect = 2.9e-13 Identity = 26/46 (56.52%), Postives = 25/46 (54.35%), Query Frame = 1
HSP 5 Score: 75.5 bits (184), Expect = 4.9e-13 Identity = 26/44 (59.09%), Postives = 25/44 (56.82%), Query Frame = 1
HSP 6 Score: 73.9 bits (180), Expect = 1.4e-12 Identity = 25/44 (56.82%), Postives = 24/44 (54.55%), Query Frame = 1
HSP 7 Score: 73.9 bits (180), Expect = 1.4e-12 Identity = 25/41 (60.98%), Postives = 23/41 (56.10%), Query Frame = 1
HSP 8 Score: 73.6 bits (179), Expect = 1.9e-12 Identity = 24/39 (61.54%), Postives = 22/39 (56.41%), Query Frame = 1
HSP 9 Score: 73.6 bits (179), Expect = 1.9e-12 Identity = 24/39 (61.54%), Postives = 22/39 (56.41%), Query Frame = 1
HSP 10 Score: 73.6 bits (179), Expect = 1.9e-12 Identity = 24/39 (61.54%), Postives = 22/39 (56.41%), Query Frame = 1
HSP 11 Score: 72.4 bits (176), Expect = 4.1e-12 Identity = 25/41 (60.98%), Postives = 23/41 (56.10%), Query Frame = 1
HSP 12 Score: 72.4 bits (176), Expect = 4.1e-12 Identity = 26/45 (57.78%), Postives = 25/45 (55.56%), Query Frame = 1
HSP 13 Score: 72.0 bits (175), Expect = 5.4e-12 Identity = 26/42 (61.90%), Postives = 24/42 (57.14%), Query Frame = 1
HSP 14 Score: 72.0 bits (175), Expect = 5.4e-12 Identity = 26/46 (56.52%), Postives = 25/46 (54.35%), Query Frame = 1
HSP 15 Score: 72.0 bits (175), Expect = 5.4e-12 Identity = 26/46 (56.52%), Postives = 25/46 (54.35%), Query Frame = 1
HSP 16 Score: 71.6 bits (174), Expect = 7.1e-12 Identity = 25/44 (56.82%), Postives = 24/44 (54.55%), Query Frame = 1
HSP 17 Score: 71.6 bits (174), Expect = 7.1e-12 Identity = 26/43 (60.47%), Postives = 24/43 (55.81%), Query Frame = 1
HSP 18 Score: 71.6 bits (174), Expect = 7.1e-12 Identity = 26/46 (56.52%), Postives = 25/46 (54.35%), Query Frame = 1
HSP 19 Score: 70.1 bits (170), Expect = 2.1e-11 Identity = 24/44 (54.55%), Postives = 23/44 (52.27%), Query Frame = 1
HSP 20 Score: 69.3 bits (168), Expect = 3.5e-11 Identity = 26/49 (53.06%), Postives = 25/49 (51.02%), Query Frame = 1
HSP 21 Score: 68.6 bits (166), Expect = 6.0e-11 Identity = 25/43 (58.14%), Postives = 23/43 (53.49%), Query Frame = 1
HSP 22 Score: 66.2 bits (160), Expect = 3.0e-10 Identity = 23/41 (56.10%), Postives = 22/41 (53.66%), Query Frame = 1
HSP 23 Score: 65.9 bits (159), Expect = 3.9e-10 Identity = 21/39 (53.85%), Postives = 21/39 (53.85%), Query Frame = 1
HSP 24 Score: 65.1 bits (157), Expect = 6.6e-10 Identity = 25/53 (47.17%), Postives = 25/53 (47.17%), Query Frame = 1
HSP 25 Score: 64.3 bits (155), Expect = 1.1e-09 Identity = 24/51 (47.06%), Postives = 24/51 (47.06%), Query Frame = 1
HSP 26 Score: 63.9 bits (154), Expect = 1.5e-09 Identity = 21/40 (52.50%), Postives = 21/40 (52.50%), Query Frame = 1
HSP 27 Score: 61.2 bits (147), Expect = 9.5e-09 Identity = 24/53 (45.28%), Postives = 24/53 (45.28%), Query Frame = 1
HSP 28 Score: 56.6 bits (135), Expect = 2.3e-07 Identity = 25/60 (41.67%), Postives = 28/60 (46.67%), Query Frame = 1
BLAST of Csa6G430670.2 vs. Swiss-Prot
Match: PAP1B_DICDI (Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 6.4e-13 Identity = 28/45 (62.22%), Postives = 30/45 (66.67%), Query Frame = 1
HSP 2 Score: 61.2 bits (147), Expect = 9.5e-09 Identity = 28/78 (35.90%), Postives = 29/78 (37.18%), Query Frame = 1
BLAST of Csa6G430670.2 vs. Swiss-Prot
Match: CSUP_DROME (Protein catecholamines up OS=Drosophila melanogaster GN=Catsup PE=2 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 4.6e-11 Identity = 28/62 (45.16%), Postives = 31/62 (50.00%), Query Frame = 1
HSP 2 Score: 66.2 bits (160), Expect = 3.0e-10 Identity = 25/41 (60.98%), Postives = 26/41 (63.41%), Query Frame = 1
HSP 3 Score: 62.4 bits (150), Expect = 4.3e-09 Identity = 27/66 (40.91%), Postives = 28/66 (42.42%), Query Frame = 1
BLAST of Csa6G430670.2 vs. Swiss-Prot
Match: RCNA_ECO57 (Nickel/cobalt efflux system RcnA OS=Escherichia coli O157:H7 GN=rcnA PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.3e-10 Identity = 22/41 (53.66%), Postives = 24/41 (58.54%), Query Frame = 1
HSP 2 Score: 53.9 bits (128), Expect = 1.5e-06 Identity = 22/47 (46.81%), Postives = 26/47 (55.32%), Query Frame = 1
HSP 3 Score: 53.9 bits (128), Expect = 1.5e-06 Identity = 20/47 (42.55%), Postives = 24/47 (51.06%), Query Frame = 1
HSP 4 Score: 51.6 bits (122), Expect = 7.6e-06 Identity = 20/54 (37.04%), Postives = 27/54 (50.00%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TrEMBL
Match: A0A0A0KK09_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G430670 PE=4 SV=1) HSP 1 Score: 271.2 bits (692), Expect = 6.8e-70 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TrEMBL
Match: A0A158PWY8_BRUMA (Uncharacterized protein OS=Brugia malayi PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 7.3e-16 Identity = 32/57 (56.14%), Postives = 34/57 (59.65%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TrEMBL
Match: A0A158PWY8_BRUMA (Uncharacterized protein OS=Brugia malayi PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 6.9e-14 Identity = 32/64 (50.00%), Postives = 34/64 (53.12%), Query Frame = 1
HSP 2 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 3 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 4 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 5 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 6 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 7 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 8 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 9 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 10 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 11 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 12 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 13 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 14 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 15 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 16 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 17 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 18 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 19 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 20 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 21 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 22 Score: 83.2 bits (204), Expect = 2.6e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 23 Score: 87.4 bits (215), Expect = 1.4e-14 Identity = 28/41 (68.29%), Postives = 29/41 (70.73%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TrEMBL
Match: A0A0L8HSB7_OCTBM (Uncharacterized protein (Fragment) OS=Octopus bimaculoides GN=OCBIM_22008381mg PE=4 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.8e-14 Identity = 28/39 (71.79%), Postives = 28/39 (71.79%), Query Frame = 1
HSP 2 Score: 86.3 bits (212), Expect = 3.1e-14 Identity = 27/39 (69.23%), Postives = 28/39 (71.79%), Query Frame = 1
HSP 3 Score: 83.6 bits (205), Expect = 2.0e-13 Identity = 26/39 (66.67%), Postives = 27/39 (69.23%), Query Frame = 1
HSP 4 Score: 82.8 bits (203), Expect = 3.4e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 5 Score: 82.8 bits (203), Expect = 3.4e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 6 Score: 82.8 bits (203), Expect = 3.4e-13 Identity = 26/40 (65.00%), Postives = 27/40 (67.50%), Query Frame = 1
HSP 7 Score: 82.0 bits (201), Expect = 5.8e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 8 Score: 81.3 bits (199), Expect = 9.9e-13 Identity = 25/40 (62.50%), Postives = 27/40 (67.50%), Query Frame = 1
HSP 9 Score: 81.3 bits (199), Expect = 9.9e-13 Identity = 25/39 (64.10%), Postives = 27/39 (69.23%), Query Frame = 1
HSP 10 Score: 80.1 bits (196), Expect = 2.2e-12 Identity = 25/39 (64.10%), Postives = 25/39 (64.10%), Query Frame = 1
HSP 11 Score: 77.0 bits (188), Expect = 1.9e-11 Identity = 28/48 (58.33%), Postives = 29/48 (60.42%), Query Frame = 1
HSP 12 Score: 75.5 bits (184), Expect = 5.4e-11 Identity = 24/39 (61.54%), Postives = 25/39 (64.10%), Query Frame = 1
HSP 13 Score: 75.5 bits (184), Expect = 5.4e-11 Identity = 25/40 (62.50%), Postives = 27/40 (67.50%), Query Frame = 1
HSP 14 Score: 72.8 bits (177), Expect = 3.5e-10 Identity = 25/48 (52.08%), Postives = 27/48 (56.25%), Query Frame = 1
HSP 15 Score: 71.6 bits (174), Expect = 7.9e-10 Identity = 29/67 (43.28%), Postives = 37/67 (55.22%), Query Frame = 1
HSP 16 Score: 70.9 bits (172), Expect = 1.3e-09 Identity = 24/44 (54.55%), Postives = 27/44 (61.36%), Query Frame = 1
HSP 17 Score: 85.9 bits (211), Expect = 4.0e-14 Identity = 28/39 (71.79%), Postives = 28/39 (71.79%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TrEMBL
Match: A0A0L8IDL2_OCTBM (Uncharacterized protein (Fragment) OS=Octopus bimaculoides GN=OCBIM_22019662mg PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.3e-12 Identity = 27/40 (67.50%), Postives = 28/40 (70.00%), Query Frame = 1
HSP 2 Score: 80.1 bits (196), Expect = 2.2e-12 Identity = 26/43 (60.47%), Postives = 27/43 (62.79%), Query Frame = 1
HSP 3 Score: 85.9 bits (211), Expect = 4.0e-14 Identity = 27/40 (67.50%), Postives = 28/40 (70.00%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TAIR10
Match: AT5G19473.1 (AT5G19473.1 RPM1-interacting protein 4 (RIN4) family protein) HSP 1 Score: 79.7 bits (195), Expect = 1.5e-15 Identity = 39/77 (50.65%), Postives = 52/77 (67.53%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TAIR10
Match: AT3G10810.1 (AT3G10810.1 zinc finger (C3HC4-type RING finger) family protein) HSP 1 Score: 68.9 bits (167), Expect = 2.6e-12 Identity = 26/50 (52.00%), Postives = 27/50 (54.00%), Query Frame = 1
HSP 2 Score: 50.8 bits (120), Expect = 7.3e-07 Identity = 15/23 (65.22%), Postives = 15/23 (65.22%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TAIR10
Match: AT1G80480.1 (AT1G80480.1 plastid transcriptionally active 17) HSP 1 Score: 66.2 bits (160), Expect = 1.7e-11 Identity = 27/48 (56.25%), Postives = 27/48 (56.25%), Query Frame = 1
HSP 2 Score: 47.0 bits (110), Expect = 1.0e-05 Identity = 15/29 (51.72%), Postives = 15/29 (51.72%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TAIR10
Match: AT2G04620.1 (AT2G04620.1 Cation efflux family protein) HSP 1 Score: 59.7 bits (143), Expect = 1.6e-09 Identity = 21/45 (46.67%), Postives = 25/45 (55.56%), Query Frame = 1
HSP 2 Score: 57.4 bits (137), Expect = 7.8e-09 Identity = 24/54 (44.44%), Postives = 28/54 (51.85%), Query Frame = 1
HSP 3 Score: 57.0 bits (136), Expect = 1.0e-08 Identity = 19/48 (39.58%), Postives = 27/48 (56.25%), Query Frame = 1
HSP 4 Score: 45.8 bits (107), Expect = 2.3e-05 Identity = 18/47 (38.30%), Postives = 21/47 (44.68%), Query Frame = 1
BLAST of Csa6G430670.2 vs. TAIR10
Match: AT1G15730.1 (AT1G15730.1 Cobalamin biosynthesis CobW-like protein) HSP 1 Score: 56.6 bits (135), Expect = 1.3e-08 Identity = 23/61 (37.70%), Postives = 33/61 (54.10%), Query Frame = 1
HSP 2 Score: 53.5 bits (127), Expect = 1.1e-07 Identity = 23/53 (43.40%), Postives = 24/53 (45.28%), Query Frame = 1
HSP 3 Score: 51.2 bits (121), Expect = 5.6e-07 Identity = 27/73 (36.99%), Postives = 32/73 (43.84%), Query Frame = 1
BLAST of Csa6G430670.2 vs. NCBI nr
Match: gi|778716881|ref|XP_011657609.1| (PREDICTED: protein catecholamines up [Cucumis sativus]) HSP 1 Score: 271.2 bits (692), Expect = 9.7e-70 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 1
BLAST of Csa6G430670.2 vs. NCBI nr
Match: gi|918325130|gb|KOF91620.1| (hypothetical protein OCBIM_22008381mg, partial [Octopus bimaculoides]) HSP 1 Score: 87.4 bits (215), Expect = 2.0e-14 Identity = 28/41 (68.29%), Postives = 29/41 (70.73%), Query Frame = 1
BLAST of Csa6G430670.2 vs. NCBI nr
Match: gi|918325130|gb|KOF91620.1| (hypothetical protein OCBIM_22008381mg, partial [Octopus bimaculoides]) HSP 1 Score: 87.0 bits (214), Expect = 2.6e-14 Identity = 28/39 (71.79%), Postives = 28/39 (71.79%), Query Frame = 1
HSP 2 Score: 86.3 bits (212), Expect = 4.4e-14 Identity = 27/39 (69.23%), Postives = 28/39 (71.79%), Query Frame = 1
HSP 3 Score: 83.6 bits (205), Expect = 2.9e-13 Identity = 26/39 (66.67%), Postives = 27/39 (69.23%), Query Frame = 1
HSP 4 Score: 82.8 bits (203), Expect = 4.9e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 5 Score: 82.8 bits (203), Expect = 4.9e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 6 Score: 82.8 bits (203), Expect = 4.9e-13 Identity = 26/40 (65.00%), Postives = 27/40 (67.50%), Query Frame = 1
HSP 7 Score: 82.0 bits (201), Expect = 8.3e-13 Identity = 26/39 (66.67%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 8 Score: 81.3 bits (199), Expect = 1.4e-12 Identity = 25/40 (62.50%), Postives = 27/40 (67.50%), Query Frame = 1
HSP 9 Score: 81.3 bits (199), Expect = 1.4e-12 Identity = 25/39 (64.10%), Postives = 27/39 (69.23%), Query Frame = 1
HSP 10 Score: 80.1 bits (196), Expect = 3.2e-12 Identity = 25/39 (64.10%), Postives = 25/39 (64.10%), Query Frame = 1
HSP 11 Score: 77.0 bits (188), Expect = 2.7e-11 Identity = 28/48 (58.33%), Postives = 29/48 (60.42%), Query Frame = 1
HSP 12 Score: 75.5 bits (184), Expect = 7.8e-11 Identity = 24/39 (61.54%), Postives = 25/39 (64.10%), Query Frame = 1
HSP 13 Score: 75.5 bits (184), Expect = 7.8e-11 Identity = 25/40 (62.50%), Postives = 27/40 (67.50%), Query Frame = 1
HSP 14 Score: 72.8 bits (177), Expect = 5.1e-10 Identity = 25/48 (52.08%), Postives = 27/48 (56.25%), Query Frame = 1
HSP 15 Score: 71.6 bits (174), Expect = 1.1e-09 Identity = 29/67 (43.28%), Postives = 37/67 (55.22%), Query Frame = 1
HSP 16 Score: 70.9 bits (172), Expect = 1.9e-09 Identity = 24/44 (54.55%), Postives = 27/44 (61.36%), Query Frame = 1
HSP 17 Score: 86.3 bits (212), Expect = 4.4e-14 Identity = 28/46 (60.87%), Postives = 29/46 (63.04%), Query Frame = 1
BLAST of Csa6G430670.2 vs. NCBI nr
Match: gi|728806664|ref|WP_033917699.1| (cobalt transporter [Acinetobacter baumannii]) HSP 1 Score: 82.0 bits (201), Expect = 8.3e-13 Identity = 27/56 (48.21%), Postives = 30/56 (53.57%), Query Frame = 1
HSP 2 Score: 86.3 bits (212), Expect = 4.4e-14 Identity = 27/39 (69.23%), Postives = 29/39 (74.36%), Query Frame = 1
BLAST of Csa6G430670.2 vs. NCBI nr
Match: gi|1009350478|gb|KYM75976.1| (Nuclear factor 1 A-type [Atta colombica]) HSP 1 Score: 85.9 bits (211), Expect = 5.8e-14 Identity = 28/56 (50.00%), Postives = 33/56 (58.93%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|