Csa2G374660.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCAGTGTAGCAATCTCTCTTTTGGGGCTGAGTTCGTGTGCAGGGAACTTGGCTGCTAGTTTTATAATGACAACGGTTGATAATTTCAGTAAAACAATAGGAGTAAAGAGTTGGGTTTCAAGTAATATCAATGAGGGCCACAATGACTATTATTATTGGTTGCTTTTTGGTTTACTGGTTGCCAACTTTTTCTATTATCTGGCATGTAACAACTCTTATGGTCCTTCCAAGGAAGAATCAGAAGGTAGATCTAATGCTGAAGATAATAACAAGACTGTAAATTAG ATGTCCAGTGTAGCAATCTCTCTTTTGGGGCTGAGTTCGTGTGCAGGGAACTTGGCTGCTAGTTTTATAATGACAACGGTTGATAATTTCAGTAAAACAATAGGAGTAAAGAGTTGGGTTTCAAGTAATATCAATGAGGGCCACAATGACTATTATTATTGGTTGCTTTTTGGTTTACTGGTTGCCAACTTTTTCTATTATCTGGCATGTAACAACTCTTATGGTCCTTCCAAGGAAGAATCAGAAGGTAGATCTAATGCTGAAGATAATAACAAGACTGTAAATTAG ATGTCCAGTGTAGCAATCTCTCTTTTGGGGCTGAGTTCGTGTGCAGGGAACTTGGCTGCTAGTTTTATAATGACAACGGTTGATAATTTCAGTAAAACAATAGGAGTAAAGAGTTGGGTTTCAAGTAATATCAATGAGGGCCACAATGACTATTATTATTGGTTGCTTTTTGGTTTACTGGTTGCCAACTTTTTCTATTATCTGGCATGTAACAACTCTTATGGTCCTTCCAAGGAAGAATCAGAAGGTAGATCTAATGCTGAAGATAATAACAAGACTGTAAATTAG MSSVAISLLGLSSCAGNLAASFIMTTVDNFSKTIGVKSWVSSNINEGHNDYYYWLLFGLLVANFFYYLACNNSYGPSKEESEGRSNAEDNNKTVN*
BLAST of Csa2G374660.1 vs. Swiss-Prot
Match: PTR32_ARATH (Protein NRT1/ PTR FAMILY 1.1 OS=Arabidopsis thaliana GN=NPF1.1 PE=1 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 8.5e-15 Identity = 39/80 (48.75%), Postives = 48/80 (60.00%), Query Frame = 1
BLAST of Csa2G374660.1 vs. Swiss-Prot
Match: PTR6_ARATH (Protein NRT1/ PTR FAMILY 1.2 OS=Arabidopsis thaliana GN=NPF1.2 PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.2e-14 Identity = 38/87 (43.68%), Postives = 51/87 (58.62%), Query Frame = 1
BLAST of Csa2G374660.1 vs. Swiss-Prot
Match: PTR48_ARATH (Protein NRT1/ PTR FAMILY 1.3 OS=Arabidopsis thaliana GN=NPF1.3 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.4e-12 Identity = 38/75 (50.67%), Postives = 48/75 (64.00%), Query Frame = 1
BLAST of Csa2G374660.1 vs. Swiss-Prot
Match: PTR2_ARATH (Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana GN=NPF8.3 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 7.0e-09 Identity = 30/81 (37.04%), Postives = 41/81 (50.62%), Query Frame = 1
BLAST of Csa2G374660.1 vs. Swiss-Prot
Match: PTR5_ARATH (Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana GN=NPF8.2 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.0e-07 Identity = 26/63 (41.27%), Postives = 39/63 (61.90%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TrEMBL
Match: A0A0A0LP66_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G374660 PE=4 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 1.2e-47 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TrEMBL
Match: A0A0A0LPT0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G374640 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 8.0e-44 Identity = 90/95 (94.74%), Postives = 90/95 (94.74%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TrEMBL
Match: A0A0A0LLZ0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G374650 PE=4 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 3.0e-35 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TrEMBL
Match: B9RS25_RICCO (Nitrate transporter, putative OS=Ricinus communis GN=RCOM_0802140 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 6.1e-20 Identity = 50/91 (54.95%), Postives = 65/91 (71.43%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TrEMBL
Match: B9RS27_RICCO (Nitrate transporter, putative OS=Ricinus communis GN=RCOM_0802260 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.0e-20 Identity = 50/86 (58.14%), Postives = 61/86 (70.93%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TAIR10
Match: AT3G16180.1 (AT3G16180.1 Major facilitator superfamily protein) HSP 1 Score: 80.9 bits (198), Expect = 4.8e-16 Identity = 39/80 (48.75%), Postives = 48/80 (60.00%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TAIR10
Match: AT1G52190.1 (AT1G52190.1 Major facilitator superfamily protein) HSP 1 Score: 78.6 bits (192), Expect = 2.4e-15 Identity = 38/87 (43.68%), Postives = 51/87 (58.62%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TAIR10
Match: AT5G11570.1 (AT5G11570.1 Major facilitator superfamily protein) HSP 1 Score: 73.6 bits (179), Expect = 7.7e-14 Identity = 38/75 (50.67%), Postives = 48/75 (64.00%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TAIR10
Match: AT2G02040.1 (AT2G02040.1 peptide transporter 2) HSP 1 Score: 61.2 bits (147), Expect = 3.9e-10 Identity = 30/81 (37.04%), Postives = 41/81 (50.62%), Query Frame = 1
BLAST of Csa2G374660.1 vs. TAIR10
Match: AT5G01180.1 (AT5G01180.1 peptide transporter 5) HSP 1 Score: 57.4 bits (137), Expect = 5.7e-09 Identity = 26/63 (41.27%), Postives = 39/63 (61.90%), Query Frame = 1
BLAST of Csa2G374660.1 vs. NCBI nr
Match: gi|700207705|gb|KGN62824.1| (hypothetical protein Csa_2G374660 [Cucumis sativus]) HSP 1 Score: 196.8 bits (499), Expect = 1.7e-47 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Csa2G374660.1 vs. NCBI nr
Match: gi|778672065|ref|XP_011649735.1| (PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis sativus]) HSP 1 Score: 184.1 bits (466), Expect = 1.1e-43 Identity = 90/95 (94.74%), Postives = 90/95 (94.74%), Query Frame = 1
BLAST of Csa2G374660.1 vs. NCBI nr
Match: gi|659088522|ref|XP_008445026.1| (PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]) HSP 1 Score: 160.6 bits (405), Expect = 1.4e-36 Identity = 77/95 (81.05%), Postives = 83/95 (87.37%), Query Frame = 1
BLAST of Csa2G374660.1 vs. NCBI nr
Match: gi|659088518|ref|XP_008445024.1| (PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]) HSP 1 Score: 156.0 bits (393), Expect = 3.3e-35 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Csa2G374660.1 vs. NCBI nr
Match: gi|778672069|ref|XP_011649736.1| (PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Cucumis sativus]) HSP 1 Score: 155.6 bits (392), Expect = 4.3e-35 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|