Csa1G192690.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGTGAGTGACGAAGATGCTCATGTTGCAAGGCTTAAGGTTTGTAAACGAACCCCCCCCCCTTTCTTTTTGAAGTGAAATTATTGAAGAACAAATACTTGGCTTTATTGTGAATTCTCTTACAAATTGTTGTTTAATCGAAGGGGAAATATGCTGCAATGGTTGTGTGCTGGCTTCTTGGGAATGGATGCCTCTTTTCTTGGAACAGTATGCTGACCATTGAAGATTACTATGGCTATTTGTTCCCGGTTATATTCTTGAATCCCGAACTTTTTGACCAATTTATTAGAACTTCAAGGCCTACTAATTCATTTACAACCTCAATATCTTATCAATATGATGGACACTTTAAATAGAACCTTATGTTTTTCCCCTTTCGAATCCTTTCCAGAAATACCACTCTTCAAGAGTTCTTACTCTTGTGTATCAGCCGTTTGCCCTCGTAACAATCTCGATGCTCACATAG ATGGCGGTGAGTGACGAAGATGCTCATGTTGCAAGGCTTAAGGGGAAATATGCTGCAATGGTTGTGTGCTGGCTTCTTGGGAATGGATGCCTCTTTTCTTGGAACAGTATGCTGACCATTGAAGATTACTATGGCTATTTGTTCCCGAAATACCACTCTTCAAGAGTTCTTACTCTTGTGTATCAGCCGTTTGCCCTCGTAACAATCTCGATGCTCACATAG ATGGCGGTGAGTGACGAAGATGCTCATGTTGCAAGGCTTAAGGGGAAATATGCTGCAATGGTTGTGTGCTGGCTTCTTGGGAATGGATGCCTCTTTTCTTGGAACAGTATGCTGACCATTGAAGATTACTATGGCTATTTGTTCCCGAAATACCACTCTTCAAGAGTTCTTACTCTTGTGTATCAGCCGTTTGCCCTCGTAACAATCTCGATGCTCACATAG MAVSDEDAHVARLKGKYAAMVVCWLLGNGCLFSWNSMLTIEDYYGYLFPKYHSSRVLTLVYQPFALVTISMLT*
BLAST of Csa1G192690.1 vs. Swiss-Prot
Match: ENT3_ARATH (Equilibrative nucleotide transporter 3 OS=Arabidopsis thaliana GN=ENT3 PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 8.3e-18 Identity = 47/72 (65.28%), Postives = 51/72 (70.83%), Query Frame = 1
BLAST of Csa1G192690.1 vs. Swiss-Prot
Match: ENT2_ARATH (Equilibrative nucleotide transporter 2 OS=Arabidopsis thaliana GN=ENT2 PE=2 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.4e-17 Identity = 38/59 (64.41%), Postives = 45/59 (76.27%), Query Frame = 1
BLAST of Csa1G192690.1 vs. Swiss-Prot
Match: ENT4_ARATH (Equilibrative nucleotide transporter 4 OS=Arabidopsis thaliana GN=ENT4 PE=1 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.4e-17 Identity = 45/72 (62.50%), Postives = 49/72 (68.06%), Query Frame = 1
BLAST of Csa1G192690.1 vs. Swiss-Prot
Match: ENT5_ARATH (Equilibrative nucleotide transporter 5 OS=Arabidopsis thaliana GN=ENT5 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.6e-15 Identity = 39/69 (56.52%), Postives = 45/69 (65.22%), Query Frame = 1
BLAST of Csa1G192690.1 vs. Swiss-Prot
Match: ENT6_ARATH (Equilibrative nucleotide transporter 6 OS=Arabidopsis thaliana GN=ENT6 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.6e-15 Identity = 39/61 (63.93%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TrEMBL
Match: A0A0A0LW80_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G192690 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 6.8e-35 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TrEMBL
Match: W9RAP5_9ROSA (Equilibrative nucleoside transporter 4 OS=Morus notabilis GN=L484_022213 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 6.4e-25 Identity = 57/72 (79.17%), Postives = 64/72 (88.89%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TrEMBL
Match: A0A061E4K8_THECC (Major facilitator superfamily protein isoform 2 OS=Theobroma cacao GN=TCM_007894 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 1.9e-24 Identity = 54/61 (88.52%), Postives = 58/61 (95.08%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TrEMBL
Match: A0A061E2V7_THECC (Major facilitator superfamily protein isoform 1 OS=Theobroma cacao GN=TCM_007894 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 1.9e-24 Identity = 54/61 (88.52%), Postives = 58/61 (95.08%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TrEMBL
Match: K7M2T1_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_13G302800 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.4e-24 Identity = 53/61 (86.89%), Postives = 59/61 (96.72%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TAIR10
Match: AT4G05120.1 (AT4G05120.1 Major facilitator superfamily protein) HSP 1 Score: 90.5 bits (223), Expect = 4.7e-19 Identity = 47/72 (65.28%), Postives = 51/72 (70.83%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TAIR10
Match: AT3G09990.1 (AT3G09990.1 Nucleoside transporter family protein) HSP 1 Score: 89.0 bits (219), Expect = 1.4e-18 Identity = 38/59 (64.41%), Postives = 45/59 (76.27%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TAIR10
Match: AT4G05130.1 (AT4G05130.1 equilibrative nucleoside transporter 4) HSP 1 Score: 89.0 bits (219), Expect = 1.4e-18 Identity = 45/72 (62.50%), Postives = 49/72 (68.06%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TAIR10
Match: AT4G05140.1 (AT4G05140.1 Nucleoside transporter family protein) HSP 1 Score: 80.9 bits (198), Expect = 3.7e-16 Identity = 39/69 (56.52%), Postives = 45/69 (65.22%), Query Frame = 1
BLAST of Csa1G192690.1 vs. TAIR10
Match: AT4G05110.1 (AT4G05110.1 equilibrative nucleoside transporter 6) HSP 1 Score: 80.5 bits (197), Expect = 4.8e-16 Identity = 39/61 (63.93%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of Csa1G192690.1 vs. NCBI nr
Match: gi|700209976|gb|KGN65072.1| (hypothetical protein Csa_1G192690 [Cucumis sativus]) HSP 1 Score: 154.1 bits (388), Expect = 9.7e-35 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Csa1G192690.1 vs. NCBI nr
Match: gi|659118128|ref|XP_008458961.1| (PREDICTED: equilibrative nucleotide transporter 3-like isoform X2 [Cucumis melo]) HSP 1 Score: 147.5 bits (371), Expect = 9.1e-33 Identity = 70/73 (95.89%), Postives = 71/73 (97.26%), Query Frame = 1
BLAST of Csa1G192690.1 vs. NCBI nr
Match: gi|659118126|ref|XP_008458960.1| (PREDICTED: equilibrative nucleotide transporter 3-like isoform X1 [Cucumis melo]) HSP 1 Score: 147.5 bits (371), Expect = 9.1e-33 Identity = 70/73 (95.89%), Postives = 71/73 (97.26%), Query Frame = 1
BLAST of Csa1G192690.1 vs. NCBI nr
Match: gi|1009127990|ref|XP_015880986.1| (PREDICTED: equilibrative nucleotide transporter 3-like [Ziziphus jujuba]) HSP 1 Score: 122.5 bits (306), Expect = 3.1e-25 Identity = 56/68 (82.35%), Postives = 61/68 (89.71%), Query Frame = 1
BLAST of Csa1G192690.1 vs. NCBI nr
Match: gi|703096481|ref|XP_010095856.1| (Equilibrative nucleoside transporter 4 [Morus notabilis]) HSP 1 Score: 120.9 bits (302), Expect = 9.1e-25 Identity = 57/72 (79.17%), Postives = 64/72 (88.89%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|