Csa1G070070.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGCGCGACGGATCCTATGCAGAATACTACATGAAGGAGCATCCAGGCATTTCCTATGAAGCAACACAGCAACATATTCAGAAGAAGATTTCTGAAGCATGGAAGACTCTGAATACAGAACATCTCTTTTCTAATATCTTCCCCACCAGTTTCACTCAGGCTTCTCTCAATATTGCTAGAGCTGTTCCTTTGGCGTATAACTATGGTAGAAACCAATCTATCATGACAGTCGAGAAGCTTATGGAACAATATTGCTAA ATGGGGCGCGACGGATCCTATGCAGAATACTACATGAAGGAGCATCCAGGCATTTCCTATGAAGCAACACAGCAACATATTCAGAAGAAGATTTCTGAAGCATGGAAGACTCTGAATACAGAACATCTCTTTTCTAATATCTTCCCCACCAGTTTCACTCAGGCTTCTCTCAATATTGCTAGAGCTGTTCCTTTGGCGTATAACTATGGTAGAAACCAATCTATCATGACAGTCGAGAAGCTTATGGAACAATATTGCTAA ATGGGGCGCGACGGATCCTATGCAGAATACTACATGAAGGAGCATCCAGGCATTTCCTATGAAGCAACACAGCAACATATTCAGAAGAAGATTTCTGAAGCATGGAAGACTCTGAATACAGAACATCTCTTTTCTAATATCTTCCCCACCAGTTTCACTCAGGCTTCTCTCAATATTGCTAGAGCTGTTCCTTTGGCGTATAACTATGGTAGAAACCAATCTATCATGACAGTCGAGAAGCTTATGGAACAATATTGCTAA MGRDGSYAEYYMKEHPGISYEATQQHIQKKISEAWKTLNTEHLFSNIFPTSFTQASLNIARAVPLAYNYGRNQSIMTVEKLMEQYC*
BLAST of Csa1G070070.1 vs. Swiss-Prot
Match: NES1_FRAVE ((3S,6E)-nerolidol synthase 1, chloroplastic OS=Fragaria vesca PE=1 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.9e-15 Identity = 38/82 (46.34%), Postives = 52/82 (63.41%), Query Frame = 1
BLAST of Csa1G070070.1 vs. Swiss-Prot
Match: NES1_FRAAN ((3S,6E)-nerolidol synthase 1 OS=Fragaria ananassa PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.7e-14 Identity = 38/82 (46.34%), Postives = 51/82 (62.20%), Query Frame = 1
BLAST of Csa1G070070.1 vs. Swiss-Prot
Match: NES2_FRAAN ((3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial OS=Fragaria ananassa PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.9e-13 Identity = 36/82 (43.90%), Postives = 50/82 (60.98%), Query Frame = 1
BLAST of Csa1G070070.1 vs. Swiss-Prot
Match: TPS13_RICCO (Probable terpene synthase 13 OS=Ricinus communis GN=TPS13 PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-12 Identity = 36/78 (46.15%), Postives = 45/78 (57.69%), Query Frame = 1
BLAST of Csa1G070070.1 vs. Swiss-Prot
Match: LINS_ARATH (S-(+)-linalool synthase, chloroplastic OS=Arabidopsis thaliana GN=TPS14 PE=2 SV=2) HSP 1 Score: 71.6 bits (174), Expect = 4.7e-12 Identity = 35/74 (47.30%), Postives = 45/74 (60.81%), Query Frame = 1
BLAST of Csa1G070070.1 vs. TrEMBL
Match: A0A0A0LRQ7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G070070 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.4e-42 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 1
BLAST of Csa1G070070.1 vs. TrEMBL
Match: A0A0A0LUC8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G068570 PE=3 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.4e-25 Identity = 56/82 (68.29%), Postives = 67/82 (81.71%), Query Frame = 1
BLAST of Csa1G070070.1 vs. TrEMBL
Match: A0A0A0LX78_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G066550 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 6.4e-16 Identity = 45/83 (54.22%), Postives = 59/83 (71.08%), Query Frame = 1
BLAST of Csa1G070070.1 vs. TrEMBL
Match: A0A061GGG2_THECC (3S-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase, putative OS=Theobroma cacao GN=TCM_030061 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.1e-15 Identity = 42/82 (51.22%), Postives = 55/82 (67.07%), Query Frame = 1
BLAST of Csa1G070070.1 vs. TrEMBL
Match: A0A068TTV0_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00029361001 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.4e-15 Identity = 40/79 (50.63%), Postives = 57/79 (72.15%), Query Frame = 1
BLAST of Csa1G070070.1 vs. TAIR10
Match: AT1G61680.1 (AT1G61680.1 terpene synthase 14) HSP 1 Score: 71.6 bits (174), Expect = 2.6e-13 Identity = 35/74 (47.30%), Postives = 45/74 (60.81%), Query Frame = 1
BLAST of Csa1G070070.1 vs. NCBI nr
Match: gi|700209494|gb|KGN64590.1| (hypothetical protein Csa_1G070070 [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 2.0e-42 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 1
BLAST of Csa1G070070.1 vs. NCBI nr
Match: gi|659068831|ref|XP_008446523.1| (PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]) HSP 1 Score: 172.6 bits (436), Expect = 3.1e-40 Identity = 83/86 (96.51%), Postives = 84/86 (97.67%), Query Frame = 1
BLAST of Csa1G070070.1 vs. NCBI nr
Match: gi|659067871|ref|XP_008441685.1| (PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]) HSP 1 Score: 124.0 bits (310), Expect = 1.3e-25 Identity = 58/83 (69.88%), Postives = 68/83 (81.93%), Query Frame = 1
BLAST of Csa1G070070.1 vs. NCBI nr
Match: gi|778664893|ref|XP_011648432.1| (PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis sativus]) HSP 1 Score: 122.1 bits (305), Expect = 4.8e-25 Identity = 56/82 (68.29%), Postives = 67/82 (81.71%), Query Frame = 1
BLAST of Csa1G070070.1 vs. NCBI nr
Match: gi|700209493|gb|KGN64589.1| (hypothetical protein Csa_1G068570 [Cucumis sativus]) HSP 1 Score: 122.1 bits (305), Expect = 4.8e-25 Identity = 56/82 (68.29%), Postives = 67/82 (81.71%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|