Csa1G044850.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCCGTTCACAGATGCTTTGTCTTTCGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTAATTGGATAAAAGGGTGAAAAGCATGGTGTTTGAAAGCTATGGGGTTGGGAATGCATTAAGAAGCCATATGGAATCCACAAAATATCTTATGAGAATGATAAAATACCGAGTCCCAAAGGAAAAAGAGATGAATTTGGGAGCATTTCCTCATACTGATAAGAGCTTTCTCACAATTCTTCACCAAAACGAAGTAAATGGTTTACAGATCAAAACAAGAGATAACAAATGGATTCAATATCATCCTTTTTCTTCTTCTTCGACCTCATCTTTCATTGTCATGGCTGGAGATGCTTTCTTTGTAAGTTCCATCTCATTTTATTAA ATGCCCCGTTCACAGATGCTTTGTCTTTCGGTGAAAAGCATGGTGTTTGAAAGCTATGGGGTTGGGAATGCATTAAGAAGCCATATGGAATCCACAAAATATCTTATGAGAATGATAAAATACCGAGTCCCAAAGGAAAAAGAGATGAATTTGGGAGCATTTCCTCATACTGATAAGAGCTTTCTCACAATTCTTCACCAAAACGAAGTAAATGGTTTACAGATCAAAACAAGAGATAACAAATGGATTCAATATCATCCTTTTTCTTCTTCTTCGACCTCATCTTTCATTGTCATGGCTGGAGATGCTTTCTTTGTAAGTTCCATCTCATTTTATTAA ATGCCCCGTTCACAGATGCTTTGTCTTTCGGTGAAAAGCATGGTGTTTGAAAGCTATGGGGTTGGGAATGCATTAAGAAGCCATATGGAATCCACAAAATATCTTATGAGAATGATAAAATACCGAGTCCCAAAGGAAAAAGAGATGAATTTGGGAGCATTTCCTCATACTGATAAGAGCTTTCTCACAATTCTTCACCAAAACGAAGTAAATGGTTTACAGATCAAAACAAGAGATAACAAATGGATTCAATATCATCCTTTTTCTTCTTCTTCGACCTCATCTTTCATTGTCATGGCTGGAGATGCTTTCTTTGTAAGTTCCATCTCATTTTATTAA MPRSQMLCLSVKSMVFESYGVGNALRSHMESTKYLMRMIKYRVPKEKEMNLGAFPHTDKSFLTILHQNEVNGLQIKTRDNKWIQYHPFSSSSTSSFIVMAGDAFFVSSISFY*
BLAST of Csa1G044850.1 vs. Swiss-Prot
Match: AOP1L_ARATH (Probable 2-oxoglutarate-dependent dioxygenase AOP1.2 OS=Arabidopsis thaliana GN=AOP1.2 PE=2 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.7e-17 Identity = 45/102 (44.12%), Postives = 64/102 (62.75%), Query Frame = 1
BLAST of Csa1G044850.1 vs. Swiss-Prot
Match: AOP1C_ARATH (Probable 2-oxoglutarate-dependent dioxygenase AOP1 OS=Arabidopsis thaliana GN=AOP1 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.8e-17 Identity = 45/103 (43.69%), Postives = 64/103 (62.14%), Query Frame = 1
BLAST of Csa1G044850.1 vs. Swiss-Prot
Match: AOP1V_ARATH (Probable 2-oxoglutarate-dependent dioxygenase AOP1 (Fragment) OS=Arabidopsis thaliana GN=AOP1 PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.4e-16 Identity = 44/101 (43.56%), Postives = 63/101 (62.38%), Query Frame = 1
BLAST of Csa1G044850.1 vs. Swiss-Prot
Match: GAOX2_ARATH (Gibberellin 20 oxidase 2 OS=Arabidopsis thaliana GN=GA20OX2 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.3e-08 Identity = 37/103 (35.92%), Postives = 50/103 (48.54%), Query Frame = 1
BLAST of Csa1G044850.1 vs. Swiss-Prot
Match: AOP2V_ARATH (2-oxoglutarate-dependent dioxygenase AOP2 OS=Arabidopsis thaliana GN=AOP2 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 9.1e-08 Identity = 27/57 (47.37%), Postives = 39/57 (68.42%), Query Frame = 1
HSP 2 Score: 41.6 bits (96), Expect = 6.7e-03 Identity = 18/48 (37.50%), Postives = 27/48 (56.25%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TrEMBL
Match: A0A0A0LW20_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G044850 PE=4 SV=1) HSP 1 Score: 228.0 bits (580), Expect = 5.7e-57 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TrEMBL
Match: A0A0A0LT96_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G044830 PE=4 SV=1) HSP 1 Score: 208.0 bits (528), Expect = 6.1e-51 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TrEMBL
Match: A0A061GCR5_THECC (2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, putative OS=Theobroma cacao GN=TCM_028911 PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 8.8e-26 Identity = 63/98 (64.29%), Postives = 73/98 (74.49%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TrEMBL
Match: A0A061GCR5_THECC (2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, putative OS=Theobroma cacao GN=TCM_028911 PE=3 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.2e-22 Identity = 57/98 (58.16%), Postives = 68/98 (69.39%), Query Frame = 1
HSP 2 Score: 120.6 bits (301), Expect = 1.3e-24 Identity = 57/94 (60.64%), Postives = 73/94 (77.66%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TrEMBL
Match: A0A0D2T3T3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G070500 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.1e-23 Identity = 61/99 (61.62%), Postives = 71/99 (71.72%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TAIR10
Match: AT4G03070.1 (AT4G03070.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 88.6 bits (218), Expect = 2.7e-18 Identity = 45/103 (43.69%), Postives = 64/103 (62.14%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TAIR10
Match: AT1G52820.1 (AT1G52820.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 88.6 bits (218), Expect = 2.7e-18 Identity = 39/99 (39.39%), Postives = 64/99 (64.65%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TAIR10
Match: AT1G80320.1 (AT1G80320.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 87.4 bits (215), Expect = 6.0e-18 Identity = 43/94 (45.74%), Postives = 60/94 (63.83%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TAIR10
Match: AT1G52800.1 (AT1G52800.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 87.0 bits (214), Expect = 7.9e-18 Identity = 44/93 (47.31%), Postives = 61/93 (65.59%), Query Frame = 1
BLAST of Csa1G044850.1 vs. TAIR10
Match: AT1G52790.1 (AT1G52790.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 85.5 bits (210), Expect = 2.3e-17 Identity = 46/98 (46.94%), Postives = 61/98 (62.24%), Query Frame = 1
BLAST of Csa1G044850.1 vs. NCBI nr
Match: gi|700209140|gb|KGN64236.1| (hypothetical protein Csa_1G044850 [Cucumis sativus]) HSP 1 Score: 228.0 bits (580), Expect = 8.1e-57 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
BLAST of Csa1G044850.1 vs. NCBI nr
Match: gi|700209138|gb|KGN64234.1| (hypothetical protein Csa_1G044830 [Cucumis sativus]) HSP 1 Score: 208.0 bits (528), Expect = 8.7e-51 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of Csa1G044850.1 vs. NCBI nr
Match: gi|778664781|ref|XP_011660352.1| (PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 [Cucumis sativus]) HSP 1 Score: 197.2 bits (500), Expect = 1.5e-47 Identity = 100/108 (92.59%), Postives = 101/108 (93.52%), Query Frame = 1
BLAST of Csa1G044850.1 vs. NCBI nr
Match: gi|778664781|ref|XP_011660352.1| (PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 [Cucumis sativus]) HSP 1 Score: 195.7 bits (496), Expect = 4.5e-47 Identity = 96/98 (97.96%), Postives = 96/98 (97.96%), Query Frame = 1
HSP 2 Score: 195.7 bits (496), Expect = 4.5e-47 Identity = 96/98 (97.96%), Postives = 96/98 (97.96%), Query Frame = 1
BLAST of Csa1G044850.1 vs. NCBI nr
Match: gi|590619572|ref|XP_007024335.1| (2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, putative [Theobroma cacao]) HSP 1 Score: 124.4 bits (311), Expect = 1.3e-25 Identity = 63/98 (64.29%), Postives = 73/98 (74.49%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|