Csa1G033170.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGAGGAACATACAGTGATGCTTCATGGAATGTGGGCTAGCCCTTTTGTGAAAGGGGTCGAACTTGCCCTCAAAATCAAAGTCATTACTATTGAATCTGTGGAAGAAGATCTCCAAAACAAAACTCCAGAGCTTCTGAGCTTCAATCCCATTTACAAGAATGTTTCTGTACTGATCCACAGTGGAAAACCCATTTGTGAATCACTGGTGATTCTTGAAAACATCAACTAA ATGGCAGAGGAACATACAGTGATGCTTCATGGAATGTGGGCTAGCCCTTTTGTGAAAGGGGTCGAACTTGCCCTCAAAATCAAAGTCATTACTATTGAATCTGTGGAAGAAGATCTCCAAAACAAAACTCCAGAGCTTCTGAGCTTCAATCCCATTTACAAGAATGTTTCTGTACTGATCCACAGTGGAAAACCCATTTGTGAATCACTGGTGATTCTTGAAAACATCAACTAA ATGGCAGAGGAACATACAGTGATGCTTCATGGAATGTGGGCTAGCCCTTTTGTGAAAGGGGTCGAACTTGCCCTCAAAATCAAAGTCATTACTATTGAATCTGTGGAAGAAGATCTCCAAAACAAAACTCCAGAGCTTCTGAGCTTCAATCCCATTTACAAGAATGTTTCTGTACTGATCCACAGTGGAAAACCCATTTGTGAATCACTGGTGATTCTTGAAAACATCAACTAA MAEEHTVMLHGMWASPFVKGVELALKIKVITIESVEEDLQNKTPELLSFNPIYKNVSVLIHSGKPICESLVILENIN*
BLAST of Csa1G033170.1 vs. Swiss-Prot
Match: GSTU5_ARATH (Glutathione S-transferase U5 OS=Arabidopsis thaliana GN=GSTU5 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 5.7e-17 Identity = 46/77 (59.74%), Postives = 56/77 (72.73%), Query Frame = 1
BLAST of Csa1G033170.1 vs. Swiss-Prot
Match: GSTU9_ARATH (Glutathione S-transferase U9 OS=Arabidopsis thaliana GN=GSTU9 PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 9.7e-17 Identity = 40/74 (54.05%), Postives = 56/74 (75.68%), Query Frame = 1
BLAST of Csa1G033170.1 vs. Swiss-Prot
Match: GSTUA_ARATH (Glutathione S-transferase U10 OS=Arabidopsis thaliana GN=GSTU10 PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.6e-16 Identity = 39/71 (54.93%), Postives = 51/71 (71.83%), Query Frame = 1
BLAST of Csa1G033170.1 vs. Swiss-Prot
Match: GSTU7_ARATH (Glutathione S-transferase U7 OS=Arabidopsis thaliana GN=GSTU7 PE=2 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 4.1e-15 Identity = 38/71 (53.52%), Postives = 52/71 (73.24%), Query Frame = 1
BLAST of Csa1G033170.1 vs. Swiss-Prot
Match: GSTU8_ARATH (Glutathione S-transferase U8 OS=Arabidopsis thaliana GN=GSTU8 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.9e-15 Identity = 42/77 (54.55%), Postives = 53/77 (68.83%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TrEMBL
Match: A0A0A0LTD4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G033170 PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 3.2e-35 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TrEMBL
Match: A0A0A0LVI6_CUCSA (Glutathione s-transferase OS=Cucumis sativus GN=Csa_1G033160 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.6e-21 Identity = 51/76 (67.11%), Postives = 61/76 (80.26%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TrEMBL
Match: A0A0A0LSP6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G033140 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 4.5e-21 Identity = 50/76 (65.79%), Postives = 64/76 (84.21%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TrEMBL
Match: A0A0A0LTC3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G033120 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.0e-20 Identity = 49/76 (64.47%), Postives = 64/76 (84.21%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TrEMBL
Match: A0A068VLA6_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00013515001 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.0e-20 Identity = 49/74 (66.22%), Postives = 64/74 (86.49%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TAIR10
Match: AT2G29450.1 (AT2G29450.1 glutathione S-transferase tau 5) HSP 1 Score: 87.8 bits (216), Expect = 3.2e-18 Identity = 46/77 (59.74%), Postives = 56/77 (72.73%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TAIR10
Match: AT5G62480.1 (AT5G62480.1 glutathione S-transferase tau 9) HSP 1 Score: 87.0 bits (214), Expect = 5.4e-18 Identity = 40/74 (54.05%), Postives = 56/74 (75.68%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TAIR10
Match: AT1G74590.1 (AT1G74590.1 glutathione S-transferase TAU 10) HSP 1 Score: 86.3 bits (212), Expect = 9.3e-18 Identity = 39/71 (54.93%), Postives = 51/71 (71.83%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TAIR10
Match: AT2G29420.1 (AT2G29420.1 glutathione S-transferase tau 7) HSP 1 Score: 81.6 bits (200), Expect = 2.3e-16 Identity = 38/71 (53.52%), Postives = 52/71 (73.24%), Query Frame = 1
BLAST of Csa1G033170.1 vs. TAIR10
Match: AT3G09270.1 (AT3G09270.1 glutathione S-transferase TAU 8) HSP 1 Score: 80.9 bits (198), Expect = 3.9e-16 Identity = 42/77 (54.55%), Postives = 53/77 (68.83%), Query Frame = 1
BLAST of Csa1G033170.1 vs. NCBI nr
Match: gi|700208901|gb|KGN63997.1| (hypothetical protein Csa_1G033170 [Cucumis sativus]) HSP 1 Score: 155.2 bits (391), Expect = 4.6e-35 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 1
BLAST of Csa1G033170.1 vs. NCBI nr
Match: gi|778656835|ref|XP_004151688.2| (PREDICTED: glutathione S-transferase U9-like [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 3.8e-21 Identity = 51/76 (67.11%), Postives = 61/76 (80.26%), Query Frame = 1
BLAST of Csa1G033170.1 vs. NCBI nr
Match: gi|778656832|ref|XP_011649756.1| (PREDICTED: glutathione S-transferase U9-like [Cucumis sativus]) HSP 1 Score: 108.2 bits (269), Expect = 6.5e-21 Identity = 50/76 (65.79%), Postives = 64/76 (84.21%), Query Frame = 1
BLAST of Csa1G033170.1 vs. NCBI nr
Match: gi|661869435|emb|CDP21575.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 107.1 bits (266), Expect = 1.4e-20 Identity = 49/74 (66.22%), Postives = 64/74 (86.49%), Query Frame = 1
BLAST of Csa1G033170.1 vs. NCBI nr
Match: gi|778656826|ref|XP_004137407.2| (PREDICTED: glutathione S-transferase U9-like [Cucumis sativus]) HSP 1 Score: 107.1 bits (266), Expect = 1.4e-20 Identity = 49/76 (64.47%), Postives = 64/76 (84.21%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|