CsGy6G028730.1 (mRNA) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGATGCTTTCCACAAAAGCCACGTGCAATTCCCACGGTCAAGATTCCTCCTACTTCTTAGGATGGGAAGCTTATGAGAAAAACCCCTTTGATGAGACTTCTAATCCCAACGGCATCATTCAGATGGGTCTTGCCGAGAATCAAGTAATTATATATATTCTTCTTCGTATATATATATGTATACAAAAAAAATCACCATTTTTATGTTCTATTAAGAGCTCTATTACTCACCTTTTTTTTTTTCACTTTTTTTTCAGCTATCATTTGATCTTCTTGAATCATGGCTTACAAAAAATCCAGACGCAGCCAGCTTTAAACGTGATGGCAATCAATTTTTAGAGAGCTCGCTCTCTTCCAAGATTACCACGGCTTACCCGCATTCAAAAAGGCATTGGTAG ATGAAGATGCTTTCCACAAAAGCCACGTGCAATTCCCACGGTCAAGATTCCTCCTACTTCTTAGGATGGGAAGCTTATGAGAAAAACCCCTTTGATGAGACTTCTAATCCCAACGGCATCATTCAGATGGGTCTTGCCGAGAATCAACTATCATTTGATCTTCTTGAATCATGGCTTACAAAAAATCCAGACGCAGCCAGCTTTAAACGTGATGGCAATCAATTTTTAGAGAGCTCGCTCTCTTCCAAGATTACCACGGCTTACCCGCATTCAAAAAGGCATTGGTAG ATGAAGATGCTTTCCACAAAAGCCACGTGCAATTCCCACGGTCAAGATTCCTCCTACTTCTTAGGATGGGAAGCTTATGAGAAAAACCCCTTTGATGAGACTTCTAATCCCAACGGCATCATTCAGATGGGTCTTGCCGAGAATCAACTATCATTTGATCTTCTTGAATCATGGCTTACAAAAAATCCAGACGCAGCCAGCTTTAAACGTGATGGCAATCAATTTTTAGAGAGCTCGCTCTCTTCCAAGATTACCACGGCTTACCCGCATTCAAAAAGGCATTGGTAG MKMLSTKATCNSHGQDSSYFLGWEAYEKNPFDETSNPNGIIQMGLAENQLSFDLLESWLTKNPDAASFKRDGNQFLESSLSSKITTAYPHSKRHW
BLAST of CsGy6G028730.1 vs. NCBI nr
Match: ABI33818.1 (1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ABI33821.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ABI33822.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >KGN48642.1 hypothetical protein Csa_6G496450 [Cucumis sativus] >ALN97493.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ALN97497.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ALN97501.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ALN97505.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ALN97509.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ALN97513.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ALN97517.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]) HSP 1 Score: 154.8 bits (390), Expect = 1.4e-34 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. NCBI nr
Match: ACO83163.1 (1-aminocyclopropane-1-carboxylic acid synthase [Cucumis melo]) HSP 1 Score: 154.8 bits (390), Expect = 1.4e-34 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. NCBI nr
Match: NP_001284463.2 (1-aminocyclopropane-1-carboxylate synthase CMA101 [Cucumis melo]) HSP 1 Score: 154.8 bits (390), Expect = 1.4e-34 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. NCBI nr
Match: NP_001295859.1 (1-aminocyclopropane-1-carboxylate synthase CMA101 [Cucumis sativus] >BAA33376.1 ACC synthase [Cucumis sativus]) HSP 1 Score: 154.8 bits (390), Expect = 1.4e-34 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. NCBI nr
Match: AFI49625.1 (1-aminocyclopropane-1- carboxylate synthase [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 150.6 bits (379), Expect = 2.7e-33 Identity = 70/72 (97.22%), Postives = 70/72 (97.22%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TAIR10
Match: AT5G65800.1 (ACC synthase 5) HSP 1 Score: 131.0 bits (328), Expect = 4.0e-31 Identity = 59/72 (81.94%), Postives = 63/72 (87.50%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TAIR10
Match: AT4G37770.1 (1-amino-cyclopropane-1-carboxylate synthase 8) HSP 1 Score: 127.9 bits (320), Expect = 3.4e-30 Identity = 56/72 (77.78%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TAIR10
Match: AT3G49700.1 (1-aminocyclopropane-1-carboxylate synthase 9) HSP 1 Score: 126.7 bits (317), Expect = 7.5e-30 Identity = 56/77 (72.73%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TAIR10
Match: AT2G22810.1 (1-aminocyclopropane-1-carboxylate synthase 4) HSP 1 Score: 124.4 bits (311), Expect = 3.7e-29 Identity = 58/72 (80.56%), Postives = 60/72 (83.33%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TAIR10
Match: AT4G08040.1 (1-aminocyclopropane-1-carboxylate synthase 11) HSP 1 Score: 101.7 bits (252), Expect = 2.6e-22 Identity = 44/69 (63.77%), Postives = 56/69 (81.16%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. Swiss-Prot
Match: sp|Q00257|1A12_CUCMA (1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima OX=3661 GN=ACS2 PE=2 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.3e-34 Identity = 68/72 (94.44%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. Swiss-Prot
Match: sp|Q42881|1A13_SOLLC (1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum OX=4081 GN=ACS3 PE=1 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 8.5e-31 Identity = 60/72 (83.33%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. Swiss-Prot
Match: sp|Q37001|1A15_ARATH (1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana OX=3702 GN=ACS5 PE=1 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 7.2e-30 Identity = 59/72 (81.94%), Postives = 63/72 (87.50%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. Swiss-Prot
Match: sp|Q9T065|1A18_ARATH (1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana OX=3702 GN=ACS8 PE=1 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 6.1e-29 Identity = 56/72 (77.78%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. Swiss-Prot
Match: sp|Q9M2Y8|1A19_ARATH (1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana OX=3702 GN=ACS9 PE=1 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.4e-28 Identity = 56/77 (72.73%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TrEMBL
Match: tr|Q09PK3|Q09PK3_CUCSA (1-aminocyclopropane-1-carboxylate synthase OS=Cucumis sativus OX=3659 GN=ACS1 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 9.4e-35 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TrEMBL
Match: tr|C9WE71|C9WE71_CUCME (1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucumis melo OX=3656 GN=LOC103484881 PE=2 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 9.4e-35 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TrEMBL
Match: tr|O82125|O82125_CUCSA (ACC synthase OS=Cucumis sativus OX=3659 GN=CS-ACS3 PE=2 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 9.4e-35 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TrEMBL
Match: tr|I1VWI5|I1VWI5_CITLA (1-aminocyclopropane-1-carboxylate synthase OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=ACS1 PE=2 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 1.8e-33 Identity = 70/72 (97.22%), Postives = 70/72 (97.22%), Query Frame = 0
BLAST of CsGy6G028730.1 vs. TrEMBL
Match: tr|A0A1S2YS49|A0A1S2YS49_CICAR (1-aminocyclopropane-1-carboxylate synthase 3-like OS=Cicer arietinum OX=3827 GN=LOC101501111 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 4.1e-30 Identity = 62/72 (86.11%), Postives = 67/72 (93.06%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
|