CsGy6G012500.1 (mRNA) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATGTCGATACGAAGAGGAAGTTCAATTTAGTGATGCGGCTCATCGAACTTGACCGCCCTTATCTATTCTTCAGTGCCGTGTAAGTGAAAGTTTTCTAGGTTTTGTGTTCACTTTGCTTTCATTTCATTTGGATTTATATATTTTACTTTAGTTTCAGAATTTTTATCAATATTTTCCTGATTTATCCTATATTTCTTTGTTCTGTATGTACAGTTTTGACGATACAAATGCAGAAAGGTTGAGAAGGAATATTCAAAACAAAGATACAGAAACAGAGACATTCTTCTTGGATCCTAAAGATATTAATTGGGAGGATTACTTCATGAATGTCCATATTCCTGGACTAGTTAAACACATCTTCAAATGA ATGTATGTCGATACGAAGAGGAAGTTCAATTTAGTGATGCGGCTCATCGAACTTGACCGCCCTTATCTATTCTTCAGTGCCGTTTTTGACGATACAAATGCAGAAAGGTTGAGAAGGAATATTCAAAACAAAGATACAGAAACAGAGACATTCTTCTTGGATCCTAAAGATATTAATTGGGAGGATTACTTCATGAATGTCCATATTCCTGGACTAGTTAAACACATCTTCAAATGA ATGTATGTCGATACGAAGAGGAAGTTCAATTTAGTGATGCGGCTCATCGAACTTGACCGCCCTTATCTATTCTTCAGTGCCGTTTTTGACGATACAAATGCAGAAAGGTTGAGAAGGAATATTCAAAACAAAGATACAGAAACAGAGACATTCTTCTTGGATCCTAAAGATATTAATTGGGAGGATTACTTCATGAATGTCCATATTCCTGGACTAGTTAAACACATCTTCAAATGA MYVDTKRKFNLVMRLIELDRPYLFFSAVFDDTNAERLRRNIQNKDTETETFFLDPKDINWEDYFMNVHIPGLVKHIFK
BLAST of CsGy6G012500.1 vs. NCBI nr
Match: KGN46943.1 (hypothetical protein Csa_6G151800 [Cucumis sativus]) HSP 1 Score: 165.6 bits (418), Expect = 6.6e-38 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. NCBI nr
Match: XP_011658417.1 (PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis sativus]) HSP 1 Score: 165.6 bits (418), Expect = 6.6e-38 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. NCBI nr
Match: XP_016902236.1 (PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis melo]) HSP 1 Score: 156.4 bits (394), Expect = 4.0e-35 Identity = 72/77 (93.51%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. NCBI nr
Match: XP_022943504.1 (fatty acyl-CoA reductase 3-like [Cucurbita moschata]) HSP 1 Score: 136.7 bits (343), Expect = 3.3e-29 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. NCBI nr
Match: XP_022153083.1 (fatty acyl-CoA reductase 3-like [Momordica charantia]) HSP 1 Score: 136.0 bits (341), Expect = 5.6e-29 Identity = 63/78 (80.77%), Postives = 72/78 (92.31%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TAIR10
Match: AT4G33790.1 (Jojoba acyl CoA reductase-related male sterility protein) HSP 1 Score: 87.8 bits (216), Expect = 3.2e-18 Identity = 33/71 (46.48%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TAIR10
Match: AT5G22500.1 (fatty acid reductase 1) HSP 1 Score: 84.0 bits (206), Expect = 4.6e-17 Identity = 38/78 (48.72%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TAIR10
Match: AT3G44540.1 (fatty acid reductase 4) HSP 1 Score: 82.8 bits (203), Expect = 1.0e-16 Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TAIR10
Match: AT3G44550.1 (fatty acid reductase 5) HSP 1 Score: 81.6 bits (200), Expect = 2.3e-16 Identity = 40/80 (50.00%), Postives = 48/80 (60.00%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TAIR10
Match: AT3G44560.1 (fatty acid reductase 8) HSP 1 Score: 80.5 bits (197), Expect = 5.1e-16 Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. Swiss-Prot
Match: sp|Q9XGY7|FAR_SIMCH (Alcohol-forming fatty acyl-CoA reductase OS=Simmondsia chinensis OX=3999 PE=1 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 4.0e-18 Identity = 36/75 (48.00%), Postives = 53/75 (70.67%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. Swiss-Prot
Match: sp|Q93ZB9|FACR3_ARATH (Fatty acyl-CoA reductase 3 OS=Arabidopsis thaliana OX=3702 GN=FAR3 PE=1 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 5.8e-17 Identity = 33/71 (46.48%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. Swiss-Prot
Match: sp|Q39152|FACR1_ARATH (Fatty acyl-CoA reductase 1 OS=Arabidopsis thaliana OX=3702 GN=FAR1 PE=1 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 8.3e-16 Identity = 38/78 (48.72%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. Swiss-Prot
Match: sp|Q9LXN3|FACR4_ARATH (Probable fatty acyl-CoA reductase 4 OS=Arabidopsis thaliana OX=3702 GN=FAR4 PE=1 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.9e-15 Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. Swiss-Prot
Match: sp|Q0WRB0|FACR5_ARATH (Probable fatty acyl-CoA reductase 5 OS=Arabidopsis thaliana OX=3702 GN=FAR5 PE=1 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 4.1e-15 Identity = 40/80 (50.00%), Postives = 48/80 (60.00%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TrEMBL
Match: tr|A0A0A0KBS1|A0A0A0KBS1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G151800 PE=4 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 4.4e-38 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TrEMBL
Match: tr|A0A1S4E1Y4|A0A1S4E1Y4_CUCME (Fatty acyl-CoA reductase OS=Cucumis melo OX=3656 GN=LOC103498022 PE=3 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 2.7e-35 Identity = 72/77 (93.51%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TrEMBL
Match: tr|A0A1S3C9F8|A0A1S3C9F8_CUCME (Fatty acyl-CoA reductase OS=Cucumis melo OX=3656 GN=LOC103497948 PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 7.3e-25 Identity = 55/77 (71.43%), Postives = 66/77 (85.71%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TrEMBL
Match: tr|A0A0A0KDN1|A0A0A0KDN1_CUCSA (Fatty acyl-CoA reductase OS=Cucumis sativus OX=3659 GN=Csa_6G151810 PE=3 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 6.2e-24 Identity = 53/77 (68.83%), Postives = 65/77 (84.42%), Query Frame = 0
BLAST of CsGy6G012500.1 vs. TrEMBL
Match: tr|A0A2P5EFP1|A0A2P5EFP1_9ROSA (Fatty acyl-CoA reductase OS=Trema orientalis OX=63057 GN=TorRG33x02_198990 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 8.3e-21 Identity = 46/78 (58.97%), Postives = 58/78 (74.36%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
|