CsGy5G005030.1 (mRNA) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGGTTATGGCAAAAACTTCCCACAAAGGATTCACCATCGTGGCTCATCATTGCCATCCATGGCCAACTATCCACAGGCCATTGGATGTGCAAAAGGGAAACAGTATTTTCAAAGCAACAATCCAAACCCTAATTTGCTAATTGGAGCTGTTGTTGGAGGACCTGATTTCAATGATTCTTATGCAGATTCCAGACCTGATTTTGTTTATTCTGAACCAACTACTTATATTAATGCTCCTCTTGTTGGTCTCTTGGCTTACTTCAAATCCCATCCTAATTAA ATGGTGGGTTATGGCAAAAACTTCCCACAAAGGATTCACCATCGTGGCTCATCATTGCCATCCATGGCCAACTATCCACAGGCCATTGGATGTGCAAAAGGGAAACAGTATTTTCAAAGCAACAATCCAAACCCTAATTTGCTAATTGGAGCTGTTGTTGGAGGACCTGATTTCAATGATTCTTATGCAGATTCCAGACCTGATTTTGTTTATTCTGAACCAACTACTTATATTAATGCTCCTCTTGTTGGTCTCTTGGCTTACTTCAAATCCCATCCTAATTAA ATGGTGGGTTATGGCAAAAACTTCCCACAAAGGATTCACCATCGTGGCTCATCATTGCCATCCATGGCCAACTATCCACAGGCCATTGGATGTGCAAAAGGGAAACAGTATTTTCAAAGCAACAATCCAAACCCTAATTTGCTAATTGGAGCTGTTGTTGGAGGACCTGATTTCAATGATTCTTATGCAGATTCCAGACCTGATTTTGTTTATTCTGAACCAACTACTTATATTAATGCTCCTCTTGTTGGTCTCTTGGCTTACTTCAAATCCCATCCTAATTAA MVGYGKNFPQRIHHRGSSLPSMANYPQAIGCAKGKQYFQSNNPNPNLLIGAVVGGPDFNDSYADSRPDFVYSEPTTYINAPLVGLLAYFKSHPN
BLAST of CsGy5G005030.1 vs. NCBI nr
Match: XP_011654857.1 (PREDICTED: endoglucanase 4-like [Cucumis sativus]) HSP 1 Score: 204.5 bits (519), Expect = 1.6e-49 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. NCBI nr
Match: KGN50329.1 (hypothetical protein Csa_5G167210 [Cucumis sativus]) HSP 1 Score: 204.5 bits (519), Expect = 1.6e-49 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. NCBI nr
Match: XP_008436961.1 (PREDICTED: endoglucanase 8-like [Cucumis melo]) HSP 1 Score: 196.4 bits (498), Expect = 4.2e-47 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. NCBI nr
Match: XP_022969744.1 (endoglucanase 8-like [Cucurbita maxima]) HSP 1 Score: 171.0 bits (432), Expect = 1.9e-39 Identity = 78/94 (82.98%), Postives = 84/94 (89.36%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. NCBI nr
Match: XP_022928924.1 (endoglucanase 4-like [Cucurbita moschata]) HSP 1 Score: 166.0 bits (419), Expect = 6.1e-38 Identity = 76/94 (80.85%), Postives = 82/94 (87.23%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TAIR10
Match: AT1G23210.1 (glycosyl hydrolase 9B6) HSP 1 Score: 144.1 bits (362), Expect = 4.5e-35 Identity = 63/92 (68.48%), Postives = 74/92 (80.43%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TAIR10
Match: AT1G70710.1 (glycosyl hydrolase 9B1) HSP 1 Score: 142.9 bits (359), Expect = 1.0e-34 Identity = 63/92 (68.48%), Postives = 76/92 (82.61%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TAIR10
Match: AT4G39010.1 (glycosyl hydrolase 9B18) HSP 1 Score: 135.6 bits (340), Expect = 1.6e-32 Identity = 61/93 (65.59%), Postives = 73/93 (78.49%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TAIR10
Match: AT4G39000.1 (glycosyl hydrolase 9B17) HSP 1 Score: 125.9 bits (315), Expect = 1.3e-29 Identity = 55/94 (58.51%), Postives = 69/94 (73.40%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TAIR10
Match: AT4G02290.1 (glycosyl hydrolase 9B13) HSP 1 Score: 122.1 bits (305), Expect = 1.8e-28 Identity = 55/89 (61.80%), Postives = 66/89 (74.16%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. Swiss-Prot
Match: sp|O49296|GUN4_ARATH (Endoglucanase 4 OS=Arabidopsis thaliana OX=3702 GN=At1g23210 PE=2 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 8.2e-34 Identity = 63/92 (68.48%), Postives = 74/92 (80.43%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. Swiss-Prot
Match: sp|Q9CAC1|GUN8_ARATH (Endoglucanase 8 OS=Arabidopsis thaliana OX=3702 GN=CEL1 PE=2 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 1.8e-33 Identity = 63/92 (68.48%), Postives = 76/92 (82.61%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. Swiss-Prot
Match: sp|Q6Z2J3|GUN6_ORYSJ (Endoglucanase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0733300 PE=2 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 1.7e-31 Identity = 64/95 (67.37%), Postives = 74/95 (77.89%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. Swiss-Prot
Match: sp|Q93YQ7|GUN24_ARATH (Endoglucanase 24 OS=Arabidopsis thaliana OX=3702 GN=At4g39010 PE=2 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 2.9e-31 Identity = 61/93 (65.59%), Postives = 73/93 (78.49%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. Swiss-Prot
Match: sp|Q652F9|GUN17_ORYSJ (Endoglucanase 17 OS=Oryza sativa subsp. japonica OX=39947 GN=GLU13 PE=2 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.4e-30 Identity = 62/95 (65.26%), Postives = 74/95 (77.89%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TrEMBL
Match: tr|A0A0A0KN43|A0A0A0KN43_CUCSA (Endoglucanase OS=Cucumis sativus OX=3659 GN=Csa_5G167210 PE=3 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 1.0e-49 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TrEMBL
Match: tr|A0A1S3ASW3|A0A1S3ASW3_CUCME (Endoglucanase OS=Cucumis melo OX=3656 GN=LOC103482534 PE=3 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 2.8e-47 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TrEMBL
Match: tr|A0A1Q3CBV4|A0A1Q3CBV4_CEPFO (Endoglucanase OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_21042 PE=3 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 2.2e-36 Identity = 73/92 (79.35%), Postives = 78/92 (84.78%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TrEMBL
Match: tr|A0A067JF01|A0A067JF01_JATCU (Endoglucanase OS=Jatropha curcas OX=180498 GN=JCGZ_26243 PE=3 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 3.8e-36 Identity = 72/94 (76.60%), Postives = 80/94 (85.11%), Query Frame = 0
BLAST of CsGy5G005030.1 vs. TrEMBL
Match: tr|A0A2P6SMC7|A0A2P6SMC7_ROSCH (Endoglucanase OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0374571 PE=3 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 1.4e-35 Identity = 71/93 (76.34%), Postives = 77/93 (82.80%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
|