CsGy1G005310.1 (mRNA) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGAGGAACATACAGTGATGCTTCTTGGAATGTGGGCTAGCCCTTTTGTGAAAGGGGTCGAACTTGCCCTCAAAATCAAAGTCATTACTATTGAATCTGTGGAAGAAGATCTCCAAAACAAAACTCCAGAGCTTCTGAGCTTCAATCCCATTTACAAGAACGTTTCTGTACTGATCCACAGTGGAAAACCCATTTGTGAATCACTGGTGATTCTTGAAAACATCAACTAA ATGGCAGAGGAACATACAGTGATGCTTCTTGGAATGTGGGCTAGCCCTTTTGTGAAAGGGGTCGAACTTGCCCTCAAAATCAAAGTCATTACTATTGAATCTGTGGAAGAAGATCTCCAAAACAAAACTCCAGAGCTTCTGAGCTTCAATCCCATTTACAAGAACGTTTCTGTACTGATCCACAGTGGAAAACCCATTTGTGAATCACTGGTGATTCTTGAAAACATCAACTAA ATGGCAGAGGAACATACAGTGATGCTTCTTGGAATGTGGGCTAGCCCTTTTGTGAAAGGGGTCGAACTTGCCCTCAAAATCAAAGTCATTACTATTGAATCTGTGGAAGAAGATCTCCAAAACAAAACTCCAGAGCTTCTGAGCTTCAATCCCATTTACAAGAACGTTTCTGTACTGATCCACAGTGGAAAACCCATTTGTGAATCACTGGTGATTCTTGAAAACATCAACTAA MAEEHTVMLLGMWASPFVKGVELALKIKVITIESVEEDLQNKTPELLSFNPIYKNVSVLIHSGKPICESLVILENIN
BLAST of CsGy1G005310.1 vs. NCBI nr
Match: KGN63997.1 (hypothetical protein Csa_1G033170 [Cucumis sativus]) HSP 1 Score: 150.2 bits (378), Expect = 2.8e-33 Identity = 76/77 (98.70%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. NCBI nr
Match: XP_023519915.1 (glutathione S-transferase U9-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 107.5 bits (267), Expect = 2.1e-20 Identity = 51/77 (66.23%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. NCBI nr
Match: XP_022923757.1 (glutathione S-transferase U9-like [Cucurbita moschata]) HSP 1 Score: 107.1 bits (266), Expect = 2.8e-20 Identity = 51/77 (66.23%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. NCBI nr
Match: XP_023001350.1 (glutathione S-transferase U9-like [Cucurbita maxima]) HSP 1 Score: 106.7 bits (265), Expect = 3.6e-20 Identity = 51/77 (66.23%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. NCBI nr
Match: XP_011649756.1 (PREDICTED: glutathione S-transferase U9-like [Cucumis sativus] >KGN63994.1 hypothetical protein Csa_1G033140 [Cucumis sativus]) HSP 1 Score: 106.3 bits (264), Expect = 4.7e-20 Identity = 50/76 (65.79%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TAIR10
Match: AT2G29450.1 (glutathione S-transferase tau 5) HSP 1 Score: 89.7 bits (221), Expect = 8.3e-19 Identity = 47/77 (61.04%), Postives = 59/77 (76.62%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TAIR10
Match: AT2G29490.1 (glutathione S-transferase TAU 1) HSP 1 Score: 82.8 bits (203), Expect = 1.0e-16 Identity = 44/78 (56.41%), Postives = 57/78 (73.08%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TAIR10
Match: AT2G29420.1 (glutathione S-transferase tau 7) HSP 1 Score: 82.8 bits (203), Expect = 1.0e-16 Identity = 39/71 (54.93%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TAIR10
Match: AT3G09270.1 (glutathione S-transferase TAU 8) HSP 1 Score: 82.8 bits (203), Expect = 1.0e-16 Identity = 43/77 (55.84%), Postives = 56/77 (72.73%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TAIR10
Match: AT2G29440.1 (glutathione S-transferase tau 6) HSP 1 Score: 82.4 bits (202), Expect = 1.3e-16 Identity = 40/77 (51.95%), Postives = 57/77 (74.03%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. Swiss-Prot
Match: sp|P46421|GSTU5_ARATH (Glutathione S-transferase U5 OS=Arabidopsis thaliana OX=3702 GN=GSTU5 PE=2 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.5e-17 Identity = 47/77 (61.04%), Postives = 59/77 (76.62%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. Swiss-Prot
Match: sp|Q9ZW30|GSTU1_ARATH (Glutathione S-transferase U1 OS=Arabidopsis thaliana OX=3702 GN=GSTU1 PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.8e-15 Identity = 44/78 (56.41%), Postives = 57/78 (73.08%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. Swiss-Prot
Match: sp|Q9ZW24|GSTU7_ARATH (Glutathione S-transferase U7 OS=Arabidopsis thaliana OX=3702 GN=GSTU7 PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.8e-15 Identity = 39/71 (54.93%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. Swiss-Prot
Match: sp|Q9SR36|GSTU8_ARATH (Glutathione S-transferase U8 OS=Arabidopsis thaliana OX=3702 GN=GSTU8 PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.8e-15 Identity = 43/77 (55.84%), Postives = 56/77 (72.73%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. Swiss-Prot
Match: sp|Q9ZW26|GSTU6_ARATH (Glutathione S-transferase U6 OS=Arabidopsis thaliana OX=3702 GN=GSTU6 PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.4e-15 Identity = 40/77 (51.95%), Postives = 57/77 (74.03%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TrEMBL
Match: tr|A0A0A0LTD4|A0A0A0LTD4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G033170 PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.9e-33 Identity = 76/77 (98.70%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TrEMBL
Match: tr|A0A0A0LSP6|A0A0A0LSP6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G033140 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 3.1e-20 Identity = 50/76 (65.79%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TrEMBL
Match: tr|A0A0A0LTC3|A0A0A0LTC3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G033120 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 7.0e-20 Identity = 49/76 (64.47%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TrEMBL
Match: tr|A0A1S4DS79|A0A1S4DS79_CUCME (glutathione S-transferase U5 OS=Cucumis melo OX=3656 GN=LOC103488771 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.0e-19 Identity = 49/76 (64.47%), Postives = 60/76 (78.95%), Query Frame = 0
BLAST of CsGy1G005310.1 vs. TrEMBL
Match: tr|A0A068VLA6|A0A068VLA6_COFCA (Uncharacterized protein OS=Coffea canephora OX=49390 GN=GSCOC_T00013515001 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 5.9e-19 Identity = 48/74 (64.86%), Postives = 63/74 (85.14%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
|